DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Hey

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster


Alignment Length:415 Identity:93/415 - (22%)
Similarity:156/415 - (37%) Gaps:127/415 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NETNGHA---AHPVKYESEAAVSSFPYCTESSLNFSTSATAYSEDDAEYATGRRNKTSRQDP--- 64
            |.::||:   :|        .:.|.    :.:|:.|.....|||:.:      :.:.|..:|   
  Fly    50 NHSHGHSQGHSH--------GIGSL----KRTLSESDCDDLYSEESS------KEQISPSEPGSC 96

  Fly    65 --LSHR----IIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQSEC-- 121
              :|.:    :|||:||||:||.|.:|.||:|..|:::|..::||.||:::.:.|||.|||:.  
  Fly    97 QLMSRKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQSKTLD 161

  Fly   122 ------QQKESDYR-SGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTDCYKSTRSCH 179
                  |:...||. .|:.:|..|.|::|..:...|....|..||..|: :.|......|.:||.
  Fly   162 SLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHL-QYFVQQRELSAKSCA 225

  Fly   180 MPDNVS----ASSG-------SPHQAYHPPLCHLRDMLATSASDVEHSQDHNDVKDLSFRNHLNQ 233
            .|...|    :|||       :|:|:|..|                                   
  Fly   226 SPGGWSPAAPSSSGYQPNCAAAPYQSYAAP----------------------------------- 255

  Fly   234 LQRSQQAAAAAAVAAAAVAVANGSSPASNAGVDSKVPLTNGGGTGGAPPAADNVPSNSTGSGSAA 298
                  |...|.|::.....|:.|..|...|..:.|..|:|..      ..:::||:...|.|::
  Fly   256 ------ANPGAYVSSYPTLSASPSQQAQQLGGRTSVSRTSGSA------VTESLPSHDLHSDSSS 308

  Fly   299 ACAGGNSNSSGSNSSNAASSTICPPAGGSCPAKVTPLAAHQQPHQAPVITSTAP----HHHHHHT 359
            ...............:....                   |||..|.   |.|.|    ..|:.|.
  Fly   309 QQQQQQQQQQQQQQQHQQQQ-------------------HQQQQQR---TQTTPQPTQQQHYTHD 351

  Fly   360 DSSHHDFESSREPILHTDTSNMHSP 384
            .|:.|   |.::...:.:.:|.:.|
  Fly   352 HSAVH---SEQQVPTYIELTNSNRP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 24/55 (44%)
ORANGE 126..168 CDD:128787 12/42 (29%)
HeyNP_523657.1 HLH 100..156 CDD:238036 24/55 (44%)
ORANGE 172..218 CDD:128787 13/46 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.