DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and heyl

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_859425.1 Gene:heyl / 335134 ZFINID:ZDB-GENE-030131-7074 Length:310 Species:Danio rerio


Alignment Length:321 Identity:76/321 - (23%)
Similarity:124/321 - (38%) Gaps:85/321 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EDDAEYATGRRNKTSRQDPLSHR----IIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEI 106
            ||.....||..:..|....|:.:    |||||||||:|..|::|.||:|..::::|..::||.||
Zfish    23 EDSYCPVTGSMSPGSTSQILARKKRRGIIEKRRRDRINHSLSELRRLVPSAFEKQGSSKLEKAEI 87

  Fly   107 IEMAIRHLKHLQS-------ECQQKESDYRS-GYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHI 163
            ::|.:.|||.|.:       :.:....|||: |:.:|:.|..::|..:...:....:..||..|:
Zfish    88 LQMTVDHLKLLHAMGGKGYFDARALAVDYRTLGFRECVGEVVRYLSSLEGVESSDPIGARLVSHL 152

  Fly   164 DEMFKTDC-------YKSTRSCHMP-------DNVSASSGSPHQAYHPPLCHLRDM--------- 205
                 :.|       .:|..:...|       ..:.|:|........||... ||:         
Zfish   153 -----SHCASELDPLLQSPAALPFPPWPWASFPQLQAASPPASSTPFPPNAR-RDLTPHGTATIL 211

  Fly   206 -----------LATSASDVEHSQDHNDVKDL-SFRNHLNQLQRSQQAAAAAAVAAAAVAVANGSS 258
                       |:|..:.:..:.  ..|:.| |...||::||:                    .|
Zfish   212 GYPSPALRMGSLSTQGTILNPAL--TSVRQLPSVPGHLHRLQQ--------------------HS 254

  Fly   259 PASNAGVDSKVPLTNGGGTGGAPPAADNVPSNSTGSGSAAACAGGNSNSSGSNSSNAASST 319
            |....     ||.::...:..:||.....|....||.     |||....|.|:.|..|..|
Zfish   255 PEGRT-----VPSSSSSSSNSSPPQISFRPFVPAGSP-----AGGRRALSSSSKSAQAWGT 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 24/55 (44%)
ORANGE 126..168 CDD:128787 10/42 (24%)
heylNP_859425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
HLH 44..101 CDD:238036 25/56 (45%)
ORANGE 115..159 CDD:128787 11/48 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..208 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..310 19/88 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573840
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.