DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Heyl

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001101447.1 Gene:Heyl / 313575 RGDID:1305022 Length:326 Species:Rattus norvegicus


Alignment Length:361 Identity:84/361 - (23%)
Similarity:128/361 - (35%) Gaps:117/361 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EDDAEYATGRRNKTSRQ-DPLS-------------HRIIEKRRRDRMNSCLADLSRLIPPQYQRK 96
            |.|.....|:.|..|:. .||:             ..|||||||||:||.|::|.||:|..::::
  Rat    13 ESDGPIDVGQENDLSQMARPLTTPSPSQMQARKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQ 77

  Fly    97 GRGRIEKTEIIEMAIRHLKHLQS-------ECQQKESDYRS-GYMDCMKEAAKFL-----YDVHM 148
            |..::||.|:::|.:.|||.|.:       :.:....|:|| |:.:|:.|..::|     ...|.
  Rat    78 GSSKLEKAEVLQMTVDHLKMLHASGGAGFFDARALAVDFRSIGFRECLTEVVRYLGVLEGPSSHA 142

  Fly   149 QDFCHRLLGRLQEHIDEM-----------FKTDCYKSTRSCHMPDNVSASSGSPHQAYHPPLCHL 202
            .....|||..|..:..||           |....:....||                  |.|..|
  Rat   143 DPVRIRLLSHLNSYAAEMEPSPTTTGALAFPVWPWSFLHSC------------------PGLPSL 189

  Fly   203 RDMLATSASDVEHSQDHNDVKDLSFRNHLNQLQR---------SQQAAAAAAVAAAAVAVANGSS 258
            ...||.                         |.|         |......:|:.:|.|....|:.
  Rat   190 SSQLAI-------------------------LGRVPGPVLPNVSSPPYPISALRSAPVHRVPGTI 229

  Fly   259 PASNAGVDSKVPLTNGGGTG----------GAPP--------AADNVPSNSTGSGSAAACAGGNS 305
            |.:...:     |.:.|.|.          .|||        |...||.....|.:|......:.
  Rat   230 PPAQRNL-----LPSRGVTSSQRAHPPERPAAPPPTALGVRAARSIVPILPCSSPAAPGAGKSDD 289

  Fly   306 NSSGSNSSNAASSTICPPAGG----SCPAKVTPLAA 337
            ::|||.||.:.......|||.    |..:::|.:.|
  Rat   290 SASGSISSPSPLGPTGRPAGAVFYHSWVSEITEIGA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 24/64 (38%)
ORANGE 126..168 CDD:128787 14/58 (24%)
HeylNP_001101447.1 bHLH-O_HEYL 36..109 CDD:381453 25/72 (35%)
ORANGE 115..162 CDD:128787 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334639
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.