DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and her6

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_571154.2 Gene:her6 / 30288 ZFINID:ZDB-GENE-980526-144 Length:270 Species:Danio rerio


Alignment Length:308 Identity:73/308 - (23%)
Similarity:111/308 - (36%) Gaps:93/308 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 STSATAYSEDDAEYATGRRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKG--RGR 100
            :|.|:..:..|.........|:|:.      |:|||||.|:|..|..|..||....::..  ..:
Zfish    16 ATPASMNTTPDKPKTASEHRKSSKP------IMEKRRRARINESLGQLKTLILDALKKDSSRHSK 74

  Fly   101 IEKTEIIEMAIRHLKHLQSECQQKES---------DYRSGYMDCMKEAAKFLYDVHMQDFCH--- 153
            :||.:|:||.::||:::| ..|...:         .||:|:.:||.|..:||      ..|.   
Zfish    75 LEKADILEMTVKHLRNMQ-RAQMTAALNTDPTVLGKYRAGFSECMNEVTRFL------STCEGVN 132

  Fly   154 -----RLLGRLQEHIDEMFKTDCYKSTRSCHMPDNVSASSGSPHQAYHPPLCHLRDMLATSASDV 213
                 ||||.|         ..|.....:.:.|......:|.||.::..|:..:..  ||..::|
Zfish   133 TEVRTRLLGHL---------ASCMTQINAMNYPTQHQIPAGPPHPSFSQPMVQIPS--ATQQANV 186

  Fly   214 EHSQDHNDVKDLSFRNHLNQLQRSQQAAAAAAVAAAAVAVANGSSPASNAGVDSK--------VP 270
                                            |..:.|...:|||  ||...|:.        ||
Zfish   187 --------------------------------VPLSGVPCKSGSS--SNLTSDATKVYGGFQLVP 217

  Fly   271 LTNGGGTGGAPPA--ADNVP------SNSTGSGSAAACAGGNSNSSGS 310
            .|:|......|.|  |.|.|      :||......|...|..|.:|.|
Zfish   218 ATDGQFAFLIPNAAFAPNGPVIPVYANNSNTPVPVAVSPGAPSVTSDS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 19/53 (36%)
ORANGE 126..168 CDD:128787 14/58 (24%)
her6NP_571154.2 HLH 32..95 CDD:238036 22/69 (32%)
Hairy_orange 110..148 CDD:284859 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573841
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.