DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and her1

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_571153.1 Gene:her1 / 30287 ZFINID:ZDB-GENE-980526-125 Length:328 Species:Danio rerio


Alignment Length:337 Identity:65/337 - (19%)
Similarity:113/337 - (33%) Gaps:128/337 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIEKRRRDRMNSCLADL----------SRLIPPQYQRKGRGRIEKTEIIEMAIRHLK-------- 115
            :|||:||||:|..|.:|          |||..|        ::||.||:|:|:.:::        
Zfish    19 VIEKKRRDRINQRLEELRTLLLDNTLDSRLQNP--------KLEKAEILELAVEYIRTKTATARD 75

  Fly   116 ------------------------------HLQSECQQKESDYRSGYMDCMKEAAKFL------- 143
                                          .:|:........|::|:.:|:..:|.|:       
Zfish    76 QGDSSKDTHDPKPPPLLSRRPQMPCASIPESIQTHNSPSNPIYKAGFKECISRSASFIDCVEPSQ 140

  Fly   144 YDVHMQDFCHRLLGRLQEHIDEMFKTDCYKSTRSCHMPDNVSASSGSPH------QAYHPPLCHL 202
            .|..:|..||        |:|                    |.||..||      ..:||.:.:.
Zfish   141 RDSFVQGLCH--------HLD--------------------SYSSALPHGRVSSNPTHHPWIPNP 177

  Fly   203 RDMLATSASDVEHSQDH-------NDVKDLSFRNHLNQLQRSQQAAAAAAVAAAAVAVANGSSPA 260
            .....|....:.|.:.:       |.:...||. ||:...:....:...::           ||.
Zfish   178 ELSCRTDVQSIGHMRANPEPYSYANSLYPKSFM-HLHPTGQHPYLSPPYSI-----------SPP 230

  Fly   261 SNAGVDSKVPLTNGGGTGGAPPAADNVPSNSTGSGSAAACAGGNSNSSGSNSSNAASSTICPPAG 325
            .:.|..|..|..:...|..:.|.....|.:.:...:       :|:||.:.|:.:.|:|..|...
Zfish   231 PSPGFSSSSPPFSSSPTYLSVPCQFPFPPSISPHST-------DSSSSSTLSTVSLSTTSLPVVP 288

  Fly   326 G-----SCPAKV 332
            |     |.|.:|
Zfish   289 GPHLQVSSPTRV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 20/96 (21%)
ORANGE 126..168 CDD:128787 11/48 (23%)
her1NP_571153.1 HLH 10..67 CDD:238036 20/55 (36%)
Hairy_orange 118..157 CDD:284859 12/66 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.