DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Hes7

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_038941367.1 Gene:Hes7 / 287423 RGDID:1305914 Length:358 Species:Rattus norvegicus


Alignment Length:380 Identity:79/380 - (20%)
Similarity:118/380 - (31%) Gaps:154/380 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIEKRRRDRMNSCLADLSRLI--PPQYQRKGRGRIEKTEIIEMAIRHLKH---------LQSECQ 122
            ::|||||||:|..|.:|..|:  ..:.|.....::||.||:|.|:.:|:.         .:...|
  Rat    48 LVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVEPPGTARGVGQ 112

  Fly   123 QKES------DYRSGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTDCYKSTRSCHMP 181
            ::|:      :.|:|      |.|....|        |.:|.                 |...:|
  Rat   113 RREAGGWGARNARAG------EGAGSEVD--------RGVGE-----------------RPAVLP 146

  Fly   182 DNVSASSG--------SPHQAYHPPLCHLRDMLATSASDVEHSQDHNDVKDLSFRNHLNQLQRSQ 238
            |.|:.:..        .|....||..|                                      
  Rat   147 DEVNNTRACLSLCLPRCPPLHVHPASC-------------------------------------- 173

  Fly   239 QAAAAAAVAAAAVAVANGSSPASN-AGVDSKVPLTNGGGTGGAPPAADNVPSNSTGSGSAAACAG 302
                 ..:.|...:|:...:|:.| .|...:.|:        .||||..|| .|.|..:.|..:.
  Rat   174 -----LCLCARLTSVSLRPAPSLNPVGPLPRPPV--------LPPAAPGVP-RSPGQDAEALASC 224

  Fly   303 GNSN---------SSGSNSSNAASSTIC----------PP----AGGSCPAKVTPL--------- 335
            ..|.         :...::|.||.|.:.          ||    |....||...||         
  Rat   225 YLSGFRECLLRLAAFAHDASPAARSQLFSALNGYRRPKPPRPEAADPGLPAPRPPLDPASPILGP 289

  Fly   336 AAHQQP--HQAPVITSTA--PHHHHHHTDSSHHDFESSREPILHTDTSNMHSPPP 386
            |.||:|  ||.|.....|  |.|.......|     .:..|:    |..:..|||
  Rat   290 ALHQRPPVHQGPPSPRLAWSPSHCSPRAGDS-----GAPAPL----TGLLPPPPP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 19/59 (32%)
ORANGE 126..168 CDD:128787 7/47 (15%)
Hes7XP_038941367.1 bHLH-O_HES7 44..102 CDD:381468 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334643
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.