DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and HEY1

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001035798.1 Gene:HEY1 / 23462 HGNCID:4880 Length:308 Species:Homo sapiens


Alignment Length:406 Identity:89/406 - (21%)
Similarity:140/406 - (34%) Gaps:146/406 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AHPVKYESEAAVSSFPYCTESSLNFSTSATAYSEDD---AEYATGRRNKTSRQDPLSHR----II 70
            ||| :|.|          ::|.|:.:......|.|:   ...|.|..:.|:....|:.:    ||
Human     4 AHP-EYSS----------SDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGII 57

  Fly    71 EKRRRDRMNSCLADLSRLIPPQYQR----KGRGRIEKTEIIEMAIRHLKHLQS-------ECQQK 124
            |||||||:|:.|::|.||:|..:::    :|..::||.||::|.:.|||.|.:       :....
Human    58 EKRRRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHAL 122

  Fly   125 ESDYRS-GYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTDCYKSTRSCHMPDNVSASS 188
            ..|||| |:.:|:.|.|::|..:...|....|..||..|::.      |.|.|        .|:|
Human   123 AMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNN------YASQR--------EAAS 173

  Fly   189 GSPHQ-----------AYHPPLCHLRDMLATSASDVEHSQDHNDVKDLSFRNHLNQLQRSQQAAA 242
            |: |.           .:||.:.|                                         
Human   174 GA-HAGLGHIPWGTVFGHHPHIAH----------------------------------------- 196

  Fly   243 AAAVAAAAVAVANGSSPASNAGVDSKVPL---TNGGGTGGAPPAADNVPSNSTGSGSAAACAGGN 304
                                       ||   .||.|..|. .|:...|.:....|||       
Human   197 ---------------------------PLLLPQNGHGNAGT-TASPTEPHHQGRLGSA------- 226

  Fly   305 SNSSGSNSSNAASSTICPPAGGSCPAKVTPLAAHQQPHQAPVITSTAPHHHHHHTDSSHHDFE-S 368
                    ...|.:...||:|...|  |.|:.........|:::|.|.......:..|.|... :
Human   227 --------HPEAPALRAPPSGSLGP--VLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPN 281

  Fly   369 SREPILHTDTSNMHSP 384
            :..|...|..:|:..|
Human   282 ALSPSAPTQAANLGKP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 24/59 (41%)
ORANGE 126..168 CDD:128787 14/42 (33%)
HEY1NP_001035798.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 13/58 (22%)
bHLH_SF 41..126 CDD:381792 27/84 (32%)
ORANGE 124..170 CDD:128787 17/59 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..238 11/53 (21%)
YRPW motif 298..301 89/406 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140965
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.