DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Helt

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_006509452.1 Gene:Helt / 234219 MGIID:3040955 Length:241 Species:Mus musculus


Alignment Length:356 Identity:77/356 - (21%)
Similarity:126/356 - (35%) Gaps:137/356 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQS- 119
            |.|..::.|:||::||||||||:|.||.:|.:.:|....::..|::||.||:||.:::|:.|.| 
Mouse     4 RLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHSA 68

  Fly   120 ---------ECQQKESDY-RSGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTDCYKS 174
                     |...:.::| ..||.:|||....:|..|                  |..:|   |.
Mouse    69 DFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTV------------------ERMET---KD 112

  Fly   175 TRSCHMPDNVSASSGSPHQAYHPPLCHLRDMLATSASDVEHSQDHNDVKDLSFRNHLNQLQRSQQ 239
            |:...:...:.:.:....:...|||         |..:          .|.|::.|         
Mouse   113 TKYARILAFLQSKARLGAEPTFPPL---------SLPE----------PDFSYQLH--------- 149

  Fly   240 AAAAAAVAAAAVAVANGSSPASNAGVDSKVPLTNGGGTGGA---PPAADNVPSNSTGSGSAAACA 301
                         .|:...|..:.|..:..|   .|.|.|:   ||.|...|:            
Mouse   150 -------------AASPEFPGHSPGEATMFP---QGATPGSFPWPPGAARSPA------------ 186

  Fly   302 GGNSNSSGSNSSNAASSTICPPAGGSCPAKVTPLAAHQQPHQAPVITSTAPHH--HHHHTDSSHH 364
                      ....:|:|:             ||.:..|.| :|.:   ||..  ..|:.:...|
Mouse   187 ----------LPYLSSATV-------------PLPSPAQQH-SPFL---APMQGLDRHYLNLIGH 224

  Fly   365 DFESSREPILHTDTSNMHSPPPRDLLLQQHP 395
            .         |.:..|:|:|        |||
Mouse   225 G---------HPNGLNLHTP--------QHP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 23/51 (45%)
ORANGE 126..168 CDD:128787 9/42 (21%)
HeltXP_006509452.1 bHLH-O_HELT 14..69 CDD:381414 25/54 (46%)
Hairy_orange 87..127 CDD:369405 11/60 (18%)
PLN02983 <147..>213 CDD:215533 21/129 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.