DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and lin-22

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_500281.1 Gene:lin-22 / 177082 WormBaseID:WBGene00003008 Length:173 Species:Caenorhabditis elegans


Alignment Length:154 Identity:35/154 - (22%)
Similarity:62/154 - (40%) Gaps:25/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKG--RGRIEKTEIIEMAIRHLKHLQ 118
            |.|..:..||    :||:||.|:|..|:.|.:::.....:..  ..:.||.:|:|||:.:|:.|:
 Worm    19 RCKKIKNKPL----MEKKRRARINKSLSQLKQILIQDEHKNSIQHSKWEKADILEMAVEYLQQLR 79

  Fly   119 S--ECQQKESDYRSGYMDCMKE-----------AAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTD 170
            |  .|....|..........||           .|.||..:..|...::.|.:|..:      |.
 Worm    80 SAQPCSLSPSTSSISTPPTPKEEIRNIKVPLNPIASFLNPMMQQYVAYQQLAQLSMY------TQ 138

  Fly   171 CYKSTRSCHMPDNVSASSGSPHQA 194
            .:.:.....:..:...::.||..|
 Worm   139 LFNNPAGVPLRADAGVTAQSPELA 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 15/53 (28%)
ORANGE 126..168 CDD:128787 9/52 (17%)
lin-22NP_500281.1 bHLH_O_HES 29..82 CDD:381416 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.