DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Hey1

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001178774.2 Gene:Hey1 / 155437 RGDID:621403 Length:299 Species:Rattus norvegicus


Alignment Length:313 Identity:78/313 - (24%)
Similarity:129/313 - (41%) Gaps:80/313 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PYWNETNGHAAHPVKYESEAAVSSFPYCTESSLNFSTSATAYSEDDAEYATGRRNKTSRQDPLSH 67
            |.::.::......::.|.|:|        :.:.|.|::..:.|...:.....|:.:..       
  Rat     6 PDYSSSDSELDETIEVEKESA--------DENGNLSSALGSMSPTTSSQVLARKRRRG------- 55

  Fly    68 RIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQS-------ECQQKE 125
             |||||||||:|:.|::|.||:|..::::|..::||.||::|.:.|||.|.:       :.....
  Rat    56 -IIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALA 119

  Fly   126 SDYRS-GYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTDCYKSTRSC---------HM 180
            .|||| |:.:|:.|.|::|..:...|....|..||..|::.      |.|.|..         |:
  Rat   120 MDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNN------YASQREAASGAHGGLGHI 178

  Fly   181 PDNVSASSGSPHQAYHPPLC--HLRDMLATSASDVE-HSQDHNDVKDLSFRNHLNQLQRSQQAAA 242
            |.. ||....||.| ||.|.  :......|:||..| |.|                         
  Rat   179 PWG-SAFGHHPHIA-HPLLLPQNGHGNAGTTASPTEPHHQ------------------------- 216

  Fly   243 AAAVAAAAVAVANGSSPASNA----GVDSKVPLTNGGGTGGAPPAADNVPSNS 291
                  ..:|.|:..:||..|    |:...:|:.. ..:..:||...:|.|.|
  Rat   217 ------GRLASAHPEAPALRAPPSGGLGPVLPVVT-SASKLSPPLLSSVASLS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 24/51 (47%)
ORANGE 126..168 CDD:128787 14/42 (33%)
Hey1NP_001178774.2 bHLH_SF 41..122 CDD:412148 26/88 (30%)
ORANGE 120..166 CDD:128787 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.