DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Hes5

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_006538625.3 Gene:Hes5 / 15208 MGIID:104876 Length:415 Species:Mus musculus


Alignment Length:139 Identity:37/139 - (26%)
Similarity:58/139 - (41%) Gaps:44/139 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 AEYATGRRNKTSRQDPLSHR--------IIEKRRRDRMNSCLADLSRLIPPQYQR-KGRGRIEKT 104
            |..|.|....|...:.||.:        ::||.||||:||.:..|..|:..::.| :...::||.
Mouse   213 ASRAPGMAPSTVAVEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKA 277

  Fly   105 EIIEMAIRHLKHLQSE---C--------------------------------QQKESDYRSGYMD 134
            :|:|||:.:|||.:.|   |                                :....||..||..
Mouse   278 DILEMAVSYLKHSKGEPGACARLLLPADVAPTARAPLMPLRLPTAFAAAAGPKSLHQDYSEGYSW 342

  Fly   135 CMKEAAKFL 143
            |::||.:||
Mouse   343 CLQEAVQFL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 21/60 (35%)
ORANGE 126..168 CDD:128787 9/18 (50%)
Hes5XP_006538625.3 bHLH-O_HES5 236..292 CDD:381467 20/55 (36%)
ORANGE 334..369 CDD:128787 9/18 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830934
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.