DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Hes3

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_011248491.1 Gene:Hes3 / 15207 MGIID:104877 Length:291 Species:Mus musculus


Alignment Length:179 Identity:45/179 - (25%)
Similarity:78/179 - (43%) Gaps:21/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 AEYATGRRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGR-IEKTEIIEMAIR 112
            |:.|...|:...:...:|..::||:||.|:|..|..|..|:...|..:.|.| :||.:|:|::::
Mouse    96 AQPAASERSGVLKGMGISKPLMEKKRRARINVSLEQLRSLLERHYSHQIRKRKLEKADILELSVK 160

  Fly   113 HLKHLQSECQ-----QKESDYRSGYMDCMKEAAKFLY----DVHMQDFCHRLLGRLQEHIDEMFK 168
            :::.||:..|     ....||.||:...::..::.|.    |..::  |..||.|.:....:...
Mouse   161 YMRSLQNSLQGLWPVPSGVDYPSGFQGGLRGVSQRLRPGEGDSGLR--CPLLLQRREGSTTDSAN 223

  Fly   169 TDCYKSTRSC----HMPDNVSASSGSPHQAYHPPLCHLRDMLATSASDV 213
            .........|    ..|...:..|.||..    || .|...|..|::||
Mouse   224 PQATSVLNPCLPAIWAPSRAAGGSHSPQS----PL-PLPGGLLESSTDV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 17/52 (33%)
ORANGE 126..168 CDD:128787 10/45 (22%)
Hes3XP_011248491.1 bHLH-O_HES3 117..171 CDD:381503 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830921
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.