DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Bhlhe41

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_038964817.1 Gene:Bhlhe41 / 117095 RGDID:70900 Length:410 Species:Rattus norvegicus


Alignment Length:386 Identity:91/386 - (23%)
Similarity:142/386 - (36%) Gaps:91/386 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQS 119
            :|:.|.....|.||:|||:||||:|.|:|.|..|:|...:....|.:||..::|:.::|||.|.:
  Rat    37 KRDDTKDTYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTA 101

  Fly   120 ECQQK------------------ESD---YRSGYMDCMKEAAKFLYDVH----MQDFCHRLLGRL 159
            ..:|:                  ::|   :.||:..|.||..::|....    .:..|.:|:..|
  Rat   102 LTEQQHQKIIALQNGERSLKSPVQADLDAFHSGFQTCAKEVLQYLARFESWTPREPRCAQLVSHL 166

  Fly   160 QEHIDEMFKTDCYKSTRSCHMP--DNVSASSGSPHQAYHPPLCHLRDMLATSASDVEHSQDHNDV 222
            .....::..............|  ...:|:|||...|...|:.    ......::.||..|    
  Rat   167 HAVATQLLTPQVTPGRGPGRAPCSAGAAAASGSERVARCVPVI----QRTQPGTEPEHDTD---- 223

  Fly   223 KDLSFRNHLNQ----------------LQRSQQAAAAA------AVAAAAVAVANGS-------- 257
            .|..:.....|                .:|.:..|..|      |:..:.||:..|:        
  Rat   224 TDSGYGGEAEQGRAAVKQEPPGDPSPAPKRLKLEARGALLGPEPALLGSLVALGGGAPFAQPAAA 288

  Fly   258 ---------SPASNAGVDSKVPLTNGGGTGG--APPAADNVPSNSTGSGSAAACAGGNSNSSGSN 311
                     ||::.|.|.   |..:..|...  .|.||...|....|..:|||.|       .:.
  Rat   289 PFCLPFYLLSPSAAAYVQ---PWLDKSGLDKYLYPAAAAPFPLLYPGIPAAAAAA-------AAA 343

  Fly   312 SSNAASSTICPPAGGSCPAKVTPLAAHQQPHQAPVITSTAPHHHHHHTDSSHH-DFESSRE 371
            :....||.:.||...:..|...|..||:   .||. .|..|.|.|..|...|. :.|||:|
  Rat   344 AFPCLSSVLSPPPEKAGSAAGAPFLAHE---VAPP-GSLRPQHAHSRTHLPHAVNPESSQE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 22/51 (43%)
ORANGE 126..168 CDD:128787 10/48 (21%)
Bhlhe41XP_038964817.1 bHLH-O_DEC2 31..122 CDD:381593 27/84 (32%)
ORANGE 129..175 CDD:128787 9/45 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.