DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and helt

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_017951230.1 Gene:helt / 100486939 XenbaseID:XB-GENE-984868 Length:252 Species:Xenopus tropicalis


Alignment Length:270 Identity:75/270 - (27%)
Similarity:111/270 - (41%) Gaps:72/270 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TAYSEDDAEYATG--RRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKT 104
            ||.:...|..|.|  .|.|..|:.|:||::||||||||:|.||::|.:.:|....::..|::||.
 Frog     4 TALASASARIALGASARVKERRRAPVSHKVIEKRRRDRINRCLSELGKTVPMALAKQNSGKLEKA 68

  Fly   105 EIIEMAIRHLKHLQSECQQKESD----------YRSGYMDCMKEAAKFLYDVHMQDFCHRLLGRL 159
            ||:||.:::|:.|.:....:..|          :..||.:|||....:|..|...:.......| 
 Frog    69 EILEMTVQYLRALHATDLPRGRDKDLLSEFANYFHYGYHECMKNLVHYLTTVERMETKDNKYAR- 132

  Fly   160 QEHIDEMFKTDCYKSTR-----------SCHM---PDNVS--------ASSGSPHQAYH-----P 197
               |....::..:.||.           ||.:   ||..|        .|.||  .::|     |
 Frog   133 ---IVAFLQSKAHLSTEPIFSPLQEVEVSCQLHSPPDYASPVDSTFPPCSGGS--FSWHGTARSP 192

  Fly   198 PLCHLRDMLATSAS-----DVEHSQDHNDVKDLSFRNHLNQLQRSQQAAAAAAVAAAAVAVANGS 257
            .|.:|....|.|.|     ...||...:.|:.|. |::||.|                     |.
 Frog   193 TLNYLGSPTAMSLSCSPSQQSAHSTFLSPVQSLD-RHYLNFL---------------------GH 235

  Fly   258 SPASNAGVDS 267
            |..||.||.|
 Frog   236 SHTSNFGVHS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 23/51 (45%)
ORANGE 126..168 CDD:128787 10/51 (20%)
heltXP_017951230.1 bHLH-O_HELT 30..85 CDD:381414 24/54 (44%)
Hairy_orange 102..142 CDD:369405 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1054305at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.