DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and her4.4

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001121862.1 Gene:her4.4 / 100149066 ZFINID:ZDB-GENE-081031-104 Length:152 Species:Danio rerio


Alignment Length:146 Identity:41/146 - (28%)
Similarity:74/146 - (50%) Gaps:17/146 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TSRQDPLSHRI----IEKRRRDRMNSCLADLSRLIPPQY-QRKGRGRIEKTEIIEMAIRHLKHLQ 118
            :||:..|::::    :||.||:|:||.:..|..|:..:: :::...|.||.:|:||.:..|:.  
Zfish    10 SSRETLLTNKLRKPMVEKIRRERINSSIEKLKTLLAQEFVKQQPDSRQEKADILEMTLDFLRR-- 72

  Fly   119 SECQQKESDYRSGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHI----DEMFKTDCYKSTRSCH 179
               .||.|....|...|::||..||....:|...|..|.:|..|:    |:..:.|..::|.. |
Zfish    73 ---SQKSSAAGDGRSRCVQEAVSFLSQCPVQTQSHTRLMKLFLHMQTPADQHTRVDNPQTTEK-H 133

  Fly   180 MPDNVSASSGSPHQAY 195
            .  |.||...:|.:::
Zfish   134 A--NSSAKQHTPARSH 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 16/56 (29%)
ORANGE 126..168 CDD:128787 13/45 (29%)
her4.4NP_001121862.1 HLH 19..75 CDD:238036 16/60 (27%)
ORANGE 77..123 CDD:128787 13/45 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.