DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and hes5.3

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_002933894.1 Gene:hes5.3 / 100101782 XenbaseID:XB-GENE-480450 Length:160 Species:Xenopus tropicalis


Alignment Length:142 Identity:42/142 - (29%)
Similarity:69/142 - (48%) Gaps:25/142 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQ-RKGRGRIEKTEIIEMAIRHLKHLQSECQ 122
            |.:::.:...::||.||||:||.:..|..|:..::| .:...:.||.:|:|:|::.||  |..|.
 Frog    21 TKQKNKIRKPMVEKMRRDRINSSINQLQNLLEKEFQLLQPDSKPEKADILELAVKFLK--QQICS 83

  Fly   123 QKES------DYRSGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTDCYKSTRSCHMP 181
            |.::      |:..||.:|:.|...||      .| ||....:|..:...|:  |..|     .|
 Frog    84 QSKNNRKDYQDFSQGYSNCLHETFAFL------SF-HRTEEEMQLKLMNHFQ--CLDS-----QP 134

  Fly   182 DNVSASSGSPHQ 193
            ..:|.||.  ||
 Frog   135 RGISVSSS--HQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 18/52 (35%)
ORANGE 126..168 CDD:128787 11/47 (23%)
hes5.3XP_002933894.1 bHLH-O_HES5 26..84 CDD:381467 20/59 (34%)
Hairy_orange 93..135 CDD:383064 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.