DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and hes5.3

DIOPT Version :10

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_002933894.1 Gene:hes5.3 / 100101782 XenbaseID:XB-GENE-480450 Length:160 Species:Xenopus tropicalis


Alignment Length:142 Identity:42/142 - (29%)
Similarity:69/142 - (48%) Gaps:25/142 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQ-RKGRGRIEKTEIIEMAIRHLKHLQSECQ 122
            |.:::.:...::||.||||:||.:..|..|:..::| .:...:.||.:|:|:|::.||  |..|.
 Frog    21 TKQKNKIRKPMVEKMRRDRINSSINQLQNLLEKEFQLLQPDSKPEKADILELAVKFLK--QQICS 83

  Fly   123 QKES------DYRSGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTDCYKSTRSCHMP 181
            |.::      |:..||.:|:.|...||      .| ||....:|..:...|:  |..|     .|
 Frog    84 QSKNNRKDYQDFSQGYSNCLHETFAFL------SF-HRTEEEMQLKLMNHFQ--CLDS-----QP 134

  Fly   182 DNVSASSGSPHQ 193
            ..:|.||.  ||
 Frog   135 RGISVSSS--HQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 bHLH-O_Cwo_like 62..121 CDD:381446 19/59 (32%)
ORANGE 126..168 CDD:128787 11/47 (23%)
hes5.3XP_002933894.1 bHLH-O_HES5 26..84 CDD:381467 20/59 (34%)
Hairy_orange 93..135 CDD:470640 14/55 (25%)

Return to query results.
Submit another query.