DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD1 and SMB1

DIOPT Version :9

Sequence 1:NP_524774.1 Gene:SmD1 / 44668 FlyBaseID:FBgn0261933 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_010946.3 Gene:SMB1 / 856751 SGDID:S000000831 Length:196 Species:Saccharomyces cerevisiae


Alignment Length:116 Identity:26/116 - (22%)
Similarity:39/116 - (33%) Gaps:42/116 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KNGTQIHGTITGVDVAMN-------------THLKSVRMTIKNRDPVHLETLSI----------- 60
            ::|....|.:...|..||             |.|..:|....::|..   ||:|           
Yeast    25 QDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDGT---TLNIKVEKRVLGLTI 86

  Fly    61 -RGNNIRYFILPDSLPL----ETLLIDDTPKS---------KTKKKDSGRV 97
             ||..|...::.|. ||    |.|:.|...|.         |.|:|..|::
Yeast    87 LRGEQILSTVVEDK-PLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKI 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD1NP_524774.1 Sm_D1 2..93 CDD:212471 24/110 (22%)
SMB1NP_010946.3 Sm_B 8..98 CDD:212464 15/75 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.