powered by:
Protein Alignment SmD1 and SME1
DIOPT Version :9
Sequence 1: | NP_524774.1 |
Gene: | SmD1 / 44668 |
FlyBaseID: | FBgn0261933 |
Length: | 124 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_014802.3 |
Gene: | SME1 / 854330 |
SGDID: | S000005685 |
Length: | 94 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 71 |
Identity: | 17/71 - (23%) |
Similarity: | 34/71 - (47%) |
Gaps: | 8/71 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHL-KSVRMTIKNRD-------PVHLETLS 59
:..||.:.:..|:.:..:.|.:|.|.|.|.|..||..: ::|.:.:.:.| ...|..:.
Yeast 17 IFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKIL 81
Fly 60 IRGNNI 65
::|:||
Yeast 82 LKGDNI 87
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmD1 | NP_524774.1 |
Sm_D1 |
2..93 |
CDD:212471 |
17/71 (24%) |
SME1 | NP_014802.3 |
Sm_E |
7..92 |
CDD:212465 |
17/71 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.