DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD1 and SME1

DIOPT Version :9

Sequence 1:NP_524774.1 Gene:SmD1 / 44668 FlyBaseID:FBgn0261933 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_014802.3 Gene:SME1 / 854330 SGDID:S000005685 Length:94 Species:Saccharomyces cerevisiae


Alignment Length:71 Identity:17/71 - (23%)
Similarity:34/71 - (47%) Gaps:8/71 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHL-KSVRMTIKNRD-------PVHLETLS 59
            :..||.:.:..|:.:..:.|.:|.|.|.|.|..||..: ::|.:.:.:.|       ...|..:.
Yeast    17 IFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKIL 81

  Fly    60 IRGNNI 65
            ::|:||
Yeast    82 LKGDNI 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD1NP_524774.1 Sm_D1 2..93 CDD:212471 17/71 (24%)
SME1NP_014802.3 Sm_E 7..92 CDD:212465 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.