powered by:
Protein Alignment SmD1 and LSM6
DIOPT Version :9
Sequence 1: | NP_524774.1 |
Gene: | SmD1 / 44668 |
FlyBaseID: | FBgn0261933 |
Length: | 124 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_010666.2 |
Gene: | LSM6 / 851984 |
SGDID: | S000002786 |
Length: | 86 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 66 |
Identity: | 16/66 - (24%) |
Similarity: | 29/66 - (43%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 FLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDPVHLETLS----IRGNNIR 66
||..:..:||.::|.:|....|.:..:|..||..|.|.....::.:...|...: :||..:.
Yeast 15 FLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVM 79
Fly 67 Y 67
|
Yeast 80 Y 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.