DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD1 and AT4G02840

DIOPT Version :9

Sequence 1:NP_524774.1 Gene:SmD1 / 44668 FlyBaseID:FBgn0261933 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001190664.1 Gene:AT4G02840 / 828163 AraportID:AT4G02840 Length:126 Species:Arabidopsis thaliana


Alignment Length:128 Identity:83/128 - (64%)
Similarity:103/128 - (80%) Gaps:14/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVRFLMKLSHETVTIELKNGTQIHGTIT----------GVDVAMNTHLKSVRMTIKNRDPVHL 55
            ||||||||||::|||:|||||||.:|||||          ||||:||||||:|::|:|.::||.|
plant     1 MKLVRFLMKLNNETVSIELKNGTIVHGTITDEYTRFYLNRGVDVSMNTHLKAVKLTLKGKNPVTL 65

  Fly    56 ETLSIRGNNIRYFILPDSLPLETLLIDDTPKSKTKKKDSGRVGNRGRGRGARGRGGPRGRGRG 118
            :.||:|||||||:||||||.|||||::|||:.|.||..:|:: ..||||| ||||  ||||||
plant    66 DHLSVRGNNIRYYILPDSLNLETLLVEDTPRIKPKKPTAGKI-PAGRGRG-RGRG--RGRGRG 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD1NP_524774.1 Sm_D1 2..93 CDD:212471 66/100 (66%)
AT4G02840NP_001190664.1 Sm_D1 2..103 CDD:212471 66/100 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2231
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H107532
Inparanoid 1 1.050 165 1.000 Inparanoid score I1588
OMA 1 1.010 - - QHG54535
OrthoDB 1 1.010 - - D1579192at2759
OrthoFinder 1 1.000 - - FOG0004375
OrthoInspector 1 1.000 - - otm2671
orthoMCL 1 0.900 - - OOG6_102452
Panther 1 1.100 - - O PTHR23338
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3100
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.