DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD1 and Snrpd2

DIOPT Version :9

Sequence 1:NP_524774.1 Gene:SmD1 / 44668 FlyBaseID:FBgn0261933 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001102869.1 Gene:Snrpd2 / 680309 RGDID:1593018 Length:118 Species:Rattus norvegicus


Alignment Length:65 Identity:13/65 - (20%)
Similarity:27/65 - (41%) Gaps:14/65 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VTIELKNGTQIHGTITGVDVAMNTHLKSVR----------MTIKNRDPV----HLETLSIRGNNI 65
            |.|..:|..::.|.:...|...|..|::|:          ...|...||    ::..:.:||:::
  Rat    42 VLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSV 106

  Fly    66  65
              Rat   107  106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD1NP_524774.1 Sm_D1 2..93 CDD:212471 13/65 (20%)
Snrpd2NP_001102869.1 Sm_D2 24..113 CDD:212467 13/65 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.