DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD1 and SNRPD1

DIOPT Version :9

Sequence 1:NP_524774.1 Gene:SmD1 / 44668 FlyBaseID:FBgn0261933 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_008869.1 Gene:SNRPD1 / 6632 HGNCID:11158 Length:119 Species:Homo sapiens


Alignment Length:124 Identity:98/124 - (79%)
Similarity:110/124 - (88%) Gaps:5/124 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDPVHLETLSIRGNNI 65
            ||||||||||||||||||||||||:|||||||||:||||||:|:||:|||:||.|||||||||||
Human     1 MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNI 65

  Fly    66 RYFILPDSLPLETLLIDDTPKSKTKKKDSGRVGNRGRGRGARGRGGPRGRGRGRASGRR 124
            |||||||||||:|||:|..||.|:||:::  |..|||||| ||||  |||||||...||
Human    66 RYFILPDSLPLDTLLVDVEPKVKSKKREA--VAGRGRGRG-RGRG--RGRGRGRGGPRR 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD1NP_524774.1 Sm_D1 2..93 CDD:212471 77/90 (86%)
SNRPD1NP_008869.1 Sufficient for interaction with CLNS1A. /evidence=ECO:0000269|PubMed:11747828 1..80 70/78 (90%)
Sm_D1 2..93 CDD:212471 77/90 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..119 21/35 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154133
Domainoid 1 1.000 123 1.000 Domainoid score I5619
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H107532
Inparanoid 1 1.050 190 1.000 Inparanoid score I3893
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54535
OrthoDB 1 1.010 - - D1579192at2759
OrthoFinder 1 1.000 - - FOG0004375
OrthoInspector 1 1.000 - - oto89361
orthoMCL 1 0.900 - - OOG6_102452
Panther 1 1.100 - - LDO PTHR23338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1357
SonicParanoid 1 1.000 - - X3100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.