DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD1 and smx5

DIOPT Version :9

Sequence 1:NP_524774.1 Gene:SmD1 / 44668 FlyBaseID:FBgn0261933 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_571571.1 Gene:smx5 / 57924 ZFINID:ZDB-GENE-000616-10 Length:95 Species:Danio rerio


Alignment Length:94 Identity:30/94 - (31%)
Similarity:44/94 - (46%) Gaps:2/94 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDP--VHLETLSIRGN 63
            |....|...|..:.|.:||||...|.||:..||..:|..|..:.:|...:.|  :.::...|||:
Zfish     1 MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGS 65

  Fly    64 NIRYFILPDSLPLETLLIDDTPKSKTKKK 92
            .:||..||.......||.|...|..|::|
Zfish    66 VVRYVQLPADEVDTQLLQDAARKEATQQK 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD1NP_524774.1 Sm_D1 2..93 CDD:212471 29/93 (31%)
smx5NP_571571.1 LSm2 2..90 CDD:212472 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.