powered by:
Protein Alignment SmD1 and snrpd2
DIOPT Version :9
Sequence 1: | NP_524774.1 |
Gene: | SmD1 / 44668 |
FlyBaseID: | FBgn0261933 |
Length: | 124 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017582.1 |
Gene: | snrpd2 / 550244 |
ZFINID: | ZDB-GENE-040914-10 |
Length: | 118 |
Species: | Danio rerio |
Alignment Length: | 65 |
Identity: | 13/65 - (20%) |
Similarity: | 27/65 - (41%) |
Gaps: | 14/65 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 VTIELKNGTQIHGTITGVDVAMNTHLKSVR----------MTIKNRDPV----HLETLSIRGNNI 65
|.|..:|..::.|.:...|...|..|::|: ...|...|| ::..:.:||:::
Zfish 42 VLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSV 106
Fly 66 65
Zfish 107 106
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmD1 | NP_524774.1 |
Sm_D1 |
2..93 |
CDD:212471 |
13/65 (20%) |
snrpd2 | NP_001017582.1 |
Sm_D2 |
24..113 |
CDD:212467 |
13/65 (20%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.