DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD1 and CG17768

DIOPT Version :9

Sequence 1:NP_524774.1 Gene:SmD1 / 44668 FlyBaseID:FBgn0261933 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001027236.1 Gene:CG17768 / 3772012 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster


Alignment Length:121 Identity:39/121 - (32%)
Similarity:61/121 - (50%) Gaps:12/121 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDPV-HLETLSIRGNNIRYFILPDSL 74
            || .:.:|||||...:|.:...|..||.:|:.|..|.|:.|.. .:....|||:.|:|..:||.:
  Fly    12 SH-PMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGSTIKYLRIPDEV 75

  Fly    75 PLETLLIDDTPKSKTK-KKDSGRVGNRGRG-RGARGRGGPR-------GRGRGRAS 121
             ::.:..|...||:.: :.:..|.||..:. ||.|..||.|       |:|.|.|:
  Fly    76 -IDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGNRPGQGYGGAA 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD1NP_524774.1 Sm_D1 2..93 CDD:212471 26/83 (31%)
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 23/66 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.