powered by:
Protein Alignment SmD1 and Lsm5
DIOPT Version :9
Sequence 1: | NP_524774.1 |
Gene: | SmD1 / 44668 |
FlyBaseID: | FBgn0261933 |
Length: | 124 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001100759.1 |
Gene: | Lsm5 / 306222 |
RGDID: | 1308655 |
Length: | 91 |
Species: | Rattus norvegicus |
Alignment Length: | 58 |
Identity: | 17/58 - (29%) |
Similarity: | 30/58 - (51%) |
Gaps: | 3/58 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 VTIELKNGTQIHGTITGVDVAMNTHLKSV---RMTIKNRDPVHLETLSIRGNNIRYFI 69
:.|.:|:..:|.||:.|.|..:|..|:.| .:|.:.|....|:.:.:.||||...:
Rat 26 IHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLV 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmD1 | NP_524774.1 |
Sm_D1 |
2..93 |
CDD:212471 |
17/58 (29%) |
Lsm5 | NP_001100759.1 |
LSm5 |
11..86 |
CDD:212479 |
17/58 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.