DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD1 and Lsm2

DIOPT Version :9

Sequence 1:NP_524774.1 Gene:SmD1 / 44668 FlyBaseID:FBgn0261933 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_085100.1 Gene:Lsm2 / 27756 MGIID:90676 Length:131 Species:Mus musculus


Alignment Length:85 Identity:26/85 - (30%)
Similarity:43/85 - (50%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDP--VHLETLSIRGNNIRYF 68
            |...|..:.|.:||||...|.||:..||..:|..|..:.:|...:.|  :.::...|||:.:||.
Mouse    42 FFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYV 106

  Fly    69 ILPDSLPLETLLIDDTPKSK 88
            .||.. .::|.|:.|..:.:
Mouse   107 QLPAD-EVDTQLLQDAARKE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD1NP_524774.1 Sm_D1 2..93 CDD:212471 26/85 (31%)
Lsm2NP_085100.1 LSm2 38..126 CDD:212472 26/85 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.