powered by:
Protein Alignment SmD1 and lsm-6
DIOPT Version :9
Sequence 1: | NP_524774.1 |
Gene: | SmD1 / 44668 |
FlyBaseID: | FBgn0261933 |
Length: | 124 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379827.1 |
Gene: | lsm-6 / 190601 |
WormBaseID: | WBGene00003080 |
Length: | 77 |
Species: | Caenorhabditis elegans |
Alignment Length: | 62 |
Identity: | 17/62 - (27%) |
Similarity: | 27/62 - (43%) |
Gaps: | 0/62 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 FLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDPVHLETLSIRGNNIRY 67
||.|:..:.|.::|.:|....|.:..:|..||..|:........:.........|||||:.|
Worm 10 FLKKVIGKPVVVKLNSGVDYRGILACLDGYMNIALEQTEEYSNGQLQNKYGDAFIRGNNVLY 71
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmD1 | NP_524774.1 |
Sm_D1 |
2..93 |
CDD:212471 |
17/62 (27%) |
lsm-6 | NP_001379827.1 |
LSm6 |
6..73 |
CDD:212473 |
17/62 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.