DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cnx99A and CALR

DIOPT Version :9

Sequence 1:NP_001036767.1 Gene:Cnx99A / 44643 FlyBaseID:FBgn0015622 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_004334.1 Gene:CALR / 811 HGNCID:1455 Length:417 Species:Homo sapiens


Alignment Length:543 Identity:158/543 - (29%)
Similarity:233/543 - (42%) Gaps:151/543 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LAYESPVIDAKKFHFADHFDDVEESRKRWVLSQAKKDDIAEEISKYDGIWNWESPQRIVWANDLG 124
            ||...|.:     :|.:.|.|.:....||:.|: .|.|..:.:......:..|.       .|.|
Human    14 LAVAEPAV-----YFKEQFLDGDGWTSRWIESK-HKSDFGKFVLSSGKFYGDEE-------KDKG 65

  Fly   125 LVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDK 189
            |.....|:..|::|.. :||..|. :.||||:.|..::..:|||.|:||.....|...:   :..
Human    66 LQTSQDARFYALSASF-EPFSNKG-QTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDM---HGD 125

  Fly   190 TPYTIMFGPDKCG-NDVKMHFIFRHVNPINGTITEKHCNKPKN-------RLEEPFKDKLPHLYQ 246
            :.|.||||||.|| ...|:|.||.:              |.||       |.::   |:..|||.
Human   126 SEYNIMFGPDICGPGTKKVHVIFNY--------------KGKNVLINKDIRCKD---DEFTHLYT 173

  Fly   247 LVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKIPDPTAHKPEDW 311
            |:|||||::|:::|:..:..|||..|:  ...||.:|.||:..|||.||||.||.|||..|||||
Human   174 LIVRPDNTYEVKIDNSQVESGSLEDDW--DFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDW 236

  Fly   312 DEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAPLVDNPVCEKAPGCGKW 376
                                 |:|:.|.||.|.||||||.|:|||||                  
Human   237 ---------------------DKPEHIPDPDAKKPEDWDEEMDGEWE------------------ 262

  Fly   377 KAPLIPNPNYKGKWRAPMIENPNYQGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDIL 441
             .|:|.||.|||:|:...|:||:|:|.|...:|.||::..|...:.......:||:||.:.|..:
Human   263 -PPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTI 326

  Fly   442 FDNLIITDDVEVARDFAANSFDIKRRYIDRESDSFVNKVVELAKANPSIWGIGLVAIVALVALTI 506
            |||.:||:|...|.:|...:                             ||:             
Human   327 FDNFLITNDEAYAEEFGNET-----------------------------WGV------------- 349

  Fly   507 YCRFGTAKSQDSAAKKAAAEAKKSDDPQPDDEPEAEEESDERAAGDTSKESTPLSASPKKNQKSD 571
                          .|||  .|:..|.|.:::...|||.|::...:...|      ..:.::..|
Human   350 --------------TKAA--EKQMKDKQDEEQRLKEEEEDKKRKEEEEAE------DKEDDEDKD 392

  Fly   572 LDDNEEESKAAESRE--PAQTEE 592
            .|:.:||.|..:..|  |.|.::
Human   393 EDEEDEEDKEEDEEEDVPGQAKD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cnx99ANP_001036767.1 Calreticulin 74..447 CDD:278680 129/380 (34%)
CALRNP_004334.1 N-domain 18..197 62/213 (29%)
Calreticulin 23..332 CDD:395201 129/380 (34%)
4 X approximate repeats 191..255 37/86 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..278 52/126 (41%)
P-domain 198..308 59/151 (39%)
Interaction with PPIB. /evidence=ECO:0000250 237..270 21/51 (41%)
3 X approximate repeats 259..297 19/56 (34%)
C-domain 309..417 34/171 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..417 19/74 (26%)
Prevents secretion from ER 414..417 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R163
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.