DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cnx99A and calr

DIOPT Version :9

Sequence 1:NP_001036767.1 Gene:Cnx99A / 44643 FlyBaseID:FBgn0015622 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_956007.2 Gene:calr / 325317 ZFINID:ZDB-GENE-030131-4042 Length:417 Species:Danio rerio


Alignment Length:536 Identity:160/536 - (29%)
Similarity:236/536 - (44%) Gaps:154/536 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 HFADHFDDVEESRKRWVLSQAKKD--DIAEEISKYDGIWNWESPQRIVWANDLGLVLKSKAKHAA 135
            :|.:.|:|.:..|.|||.|:.|.|  .......|:.|...          .|.||.....|...|
Zfish    23 YFREQFEDGDSWRSRWVESKHKTDYGKFVLSAGKFYGDAE----------KDKGLQTSQDAHFYA 77

  Fly   136 IAAPLRKPFEFKS-DKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPD 199
            ::|...   :|.: |:|||:|:.|..::..:|||.|:||..:  |..|.....|.| |.||||||
Zfish    78 MSARFG---DFNNKDQPLVIQFSVKHEQNIDCGGGYIKLFPS--DLNQEDMHGDST-YNIMFGPD 136

  Fly   200 KCG-NDVKMHFIFRHVNPINGTITEKHCNKPKNRL-EEPFK---DKLPHLYQLVVRPDNSFEIRV 259
            .|| ...|:|.||.:              |.||.| .:..:   |:..|||.|:|.|||::|:::
Zfish   137 ICGPGTKKVHVIFNY--------------KGKNHLINKDIRCKDDEYSHLYTLIVNPDNTYEVKI 187

  Fly   260 DHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKIPDPTAHKPEDWDEDAPPQLPDTDA 324
            |:|.:..|||..|:  ...|..:|.||...|||.|||||||.||...|||:|             
Zfish   188 DNKKVESGSLEEDW--DFLPSKKIKDPEAKKPEDWDEREKIDDPEDQKPEEW------------- 237

  Fly   325 VMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGK 389
                    |:|:.|.||.|.||:|||.|:|||||.|:|                   .||:|||:
Zfish   238 --------DKPENIPDPDAKKPDDWDEEMDGEWEPPMV-------------------TNPDYKGE 275

  Fly   390 WRAPMIENPNYQGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDDVEVA 454
            |:...|:||.|:|||...:|.||::..|.:.::...|..:||:||.:.|..:|||.:||:|.::|
Zfish   276 WKPRQIDNPAYKGKWVHPEIDNPEYTADSEIYKYDSIGVIGLDLWQVKSGTIFDNFLITNDPKLA 340

  Fly   455 RDFAANSFDIKRRYIDRESDSFVNKVVELAKANPSIWGIGLVAIVALVALTIYCRFGTAKSQDSA 519
            .:....:                             |                   |..|..:..
Zfish   341 EEVGTET-----------------------------W-------------------GATKDAEKK 357

  Fly   520 AKKAAAE--AKKSDDPQPDDEPEAEEESDERAAGDTSKESTPLSASPKKNQKSDLDDNEEESKAA 582
            .|::..|  .||.|:.:...:.||:||.:|                    :|.:.|:.|||.:..
Zfish   358 MKESQEEEDRKKHDEEEKSRKEEAKEEEEE--------------------EKEEEDEEEEEEEEE 402

  Fly   583 ESREPAQTEESNTKTR 598
            |..|    ||:::|.:
Zfish   403 EDEE----EETDSKLK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cnx99ANP_001036767.1 Calreticulin 74..447 CDD:278680 133/380 (35%)
calrNP_956007.2 Calreticulin 24..333 CDD:278680 133/380 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R163
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.