DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apc and Jup

DIOPT Version :9

Sequence 1:NP_001263046.1 Gene:Apc / 44642 FlyBaseID:FBgn0015589 Length:2417 Species:Drosophila melanogaster
Sequence 2:NP_112309.2 Gene:Jup / 81679 RGDID:620412 Length:745 Species:Rattus norvegicus


Alignment Length:798 Identity:148/798 - (18%)
Similarity:256/798 - (32%) Gaps:254/798 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LLSMLGSNDPLEMAKKFLELSGNAQSCATLRR-SGCMPLLVQMMHAPDN--DQEVRKCAGQALHN 290
            |..:|...||:.:.|..:.::..::..|:.|. .|...|:..::....|  |.:..:|....|||
  Rat   147 LTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHN 211

  Fly   291 VVHSHPDEKAGRREAKVLRLLDQIVDYCSFLKTLLQSGGEAIADDSDRHPLAAISSLMKVSFDEE 355
            :.|        .||.               |..:.:|||                          
  Rat   212 LSH--------HREG---------------LLAIFKSGG-------------------------- 227

  Fly   356 HRHAMCELGALHAIPNLVHLDHAVHGPKPEDQCCNSLRRYALMALTNLTFGDENNK---ALLCGQ 417
                         ||.||.:   :..|      ..|:..||:..|.||....|..|   .|..| 
  Rat   228 -------------IPALVRM---LSSP------VESVLFYAITTLHNLLLYQEGAKMAVRLADG- 269

  Fly   418 KQFMEALVAQLDSAPDDLLQVTASVLRNLSWRADSNMKAVLNEIGTVTALALAAMRNRSENTLKA 482
               ::.:|..|:......|.:|...|:.|:: .:...|.::...|....| :..|||.|...|..
  Rat   270 ---LQKMVPLLNKNNPKFLAITTDCLQLLAY-GNQESKLIILANGGPQGL-VQIMRNYSYEKLLW 329

  Fly   483 ILSALWNLSAHCSTNKAEFCAVDGALAFLVGMLSYEGPSKTLKIIENAGGILRNVSSHIAVCEPY 547
            ..|.:..:.:.|.:||.......|..|     |.....|.:.::::|....|||:|......|..
  Rat   330 TTSRVLKVLSVCPSNKPAIVEAGGMQA-----LGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGL 389

  Fly   548 RQILRQHNCLAILLQQLKSESLTVVSNSCGTLWNLSARSAEDQKFLWDNGAVPMLRSLIHS---- 608
            ..:|:      ||:.||..:.:.|::.:.|||.||:..:::::..:..|..|   .:|||:    
  Rat   390 ENVLK------ILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGV---EALIHAILRA 445

  Fly   609 -KHAMISEGSSSALKNLLNFRP---AVQNHHQLDPIARSMGLKALPTLEARKAKALQQELGERHT 669
             ....|:|.:..||::|.:..|   ..||..:|     :.|:.|:       .|.|.|       
  Rat   446 GDKDDITEPAVCALRHLTSRHPEAEMAQNSVRL-----NYGIPAI-------VKLLNQ------- 491

  Fly   670 AETCDNLDTGGKLDKERASSSSRRHPAPRLT----RSAMLTKSESRDSVYSAKSDCAYDHLIRSA 730
                                 ..:.|..:.|    |:..|               |..:|.....
  Rat   492 ---------------------PNQWPLVKATIGLIRNLAL---------------CPANHAPLQE 520

  Fly   731 SASDAHRKVKPKITDFDLEMEQDTE----ATEEQPIDYSVKYSENATKTSTYQETDLDQPTDFSL 791
            :|      |.|::....::..||.:    |..:||....|:..|                     
  Rat   521 AA------VIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEE--------------------- 558

  Fly   792 RYAENQIESDLDISGPAGGQKSTITPPAETVPEKSEGQEILLILD--DSVKCYQTEDTP-YVISN 853
                                          :.|...|...:|..|  :.::.::....| :|...
  Rat   559 ------------------------------IVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLL 593

  Fly   854 AASVTDL-RVAAKADAEAEVKPEVREVTSKEGAPKKLPKLSQC---GSGSYTPEKPINYCEEGTP 914
            .:||.:: ||||....|.....|..:....|||...|.:|...   |:.:|.........|:..|
  Rat   594 YSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNP 658

  Fly   915 GYFSRYDSLSSLDESGKANQAIVGTDADIKPKLEKQEEQESQPAEQV--LTKPPTQANSALETPL 977
            .|..|                   ...::...|.|.:....:.|:.:  :.:|......|...| 
  Rat   659 DYRKR-------------------VSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDATYRP- 703

  Fly   978 MFSRRSSMDSLVHDPDVD 995
            |:|....:|.|....|:|
  Rat   704 MYSSDVPLDPLDMHMDMD 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApcNP_001263046.1 ARM 222..316 CDD:237987 18/89 (20%)
armadillo repeat 258..332 CDD:293788 16/76 (21%)
ARM 332..448 CDD:237987 21/118 (18%)
armadillo repeat 369..403 CDD:293788 9/33 (27%)
armadillo repeat 411..448 CDD:293788 9/39 (23%)
armadillo repeat 498..539 CDD:293788 9/40 (23%)
ARM 506..624 CDD:237987 30/122 (25%)
armadillo repeat 548..582 CDD:293788 9/33 (27%)
armadillo repeat 590..624 CDD:293788 9/38 (24%)
APC_crr 837..860 CDD:283553 4/23 (17%)
APC_crr 903..927 CDD:283553 4/23 (17%)
APC_crr 1066..1090 CDD:283553
APC_crr 1247..1271 CDD:283553
JupNP_112309.2 Interaction with DSC1 and DSG1. /evidence=ECO:0000250 132..297 43/224 (19%)
armadillo repeat 144..169 CDD:293788 5/21 (24%)
armadillo repeat 186..212 CDD:293788 5/25 (20%)
armadillo repeat 221..253 CDD:293788 12/79 (15%)
Arm 221..253 CDD:395413 12/79 (15%)
armadillo repeat 261..297 CDD:293788 9/39 (23%)
ARM 5 298..341 9/43 (21%)
armadillo repeat 305..338 CDD:293788 8/33 (24%)
PLN03200 <328..>658 CDD:215629 82/455 (18%)
ARM 341..381 CDD:214547 11/44 (25%)
ARM 6 342..381 10/43 (23%)
armadillo repeat 345..380 CDD:293788 9/39 (23%)
ARM 7 383..420 12/42 (29%)
armadillo repeat 393..418 CDD:293788 9/30 (30%)
ARM 8 423..464 10/43 (23%)
armadillo repeat 426..464 CDD:293788 10/40 (25%)
ARM 9 470..510 11/79 (14%)
armadillo repeat 470..508 CDD:293788 11/77 (14%)
ARM 10 512..551 9/44 (20%)
armadillo repeat 515..572 CDD:293788 14/113 (12%)
Interaction with DSC1. /evidence=ECO:0000250 574..661 19/86 (22%)
armadillo repeat 577..611 CDD:293788 8/33 (24%)
armadillo repeat 618..652 CDD:293788 7/33 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.