DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apc and ODAD2

DIOPT Version :9

Sequence 1:NP_001263046.1 Gene:Apc / 44642 FlyBaseID:FBgn0015589 Length:2417 Species:Drosophila melanogaster
Sequence 2:XP_024303817.1 Gene:ODAD2 / 55130 HGNCID:25583 Length:1107 Species:Homo sapiens


Alignment Length:879 Identity:182/879 - (20%)
Similarity:318/879 - (36%) Gaps:193/879 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PDYEEGFGASSGEQLKMDKKYERD--GEVSDYELAA------SGYTKKEFTQDDNTLHFTQSAVG 99
            |.:.|.. :..|.....|::.|:|  |:....|.||      ||..|:..  :.|.::|.::.:.
Human   303 PKFSENM-SKLGISFSEDQQKEKDQLGKAPKKEEAAALRKDISGSDKRSL--EKNQINFWRNQMT 364

  Fly   100 ---------------LGSGAVGKKPAAKHFLD-ENPIPP-DYMLAQELREMREHRSLDRNFERQS 147
                           .|.|:..:....||... |.|.|. .:..||.||:..|  .::......|
Human   365 KRWEPSLNWKTTVNYKGKGSAKEIQEDKHTGKLEKPRPSVSHGRAQLLRKSAE--KIEETVSDSS 427

  Fly   148 AQQQQLDELPPRNGGGSPASAGRPSRSKEPSYTLSRFLDGDAPAPAPRLPKGAAWTTSFDERYTS 212
            ::.:: ||.||.:  ...|||..||...:....:.....|:..|....|.....:  |..:....
Human   428 SESEE-DEEPPDH--RQEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDF--SLAQETCQ 487

  Fly   213 SAVEATLGSKVECVYSLLSMLGSND---PLEMAKKFLELSGNAQSCATLRRSGCMPLLVQMMHAP 274
            .|:....|.:|     |:::|.:::   .:...|...|:|.|.|....:...|.:|::|.::.:|
Human   488 LAIRDVGGLEV-----LINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSP 547

  Fly   275 DNDQEVRKC-AGQALHNVVHSHPDEKAGRRE---AKVLRLLDQIVDYCSFLKTLLQSGGEAIADD 335
               .:..|| |.:.:.||.......:..|:.   .|::.|||     |:...|.........|.|
Human   548 ---HKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLD-----CAHDSTKPAQSSLYEARD 604

  Fly   336 SDRHPLAAISSLMKVSFDEEHRHAMCELGALHAIPNLVHLDH-----AVHGPKPEDQCCNSLRRY 395
            .:.....|: :|...|....::.|:.:.|.:..:..|:...|     .|.|...|   |.|    
Human   605 VEVARCGAL-ALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQE---CAS---- 661

  Fly   396 ALMALTNLTFGDENNKALLCGQKQFMEALVAQLDSAPDDLLQVTASVLRNLSWRADSNMKAVLNE 460
                       :||.:|.:..:: .:|.||..|:|..:.|.:..|..:...:  .|...:.::..
Human   662 -----------EENYRAAIKAER-IIENLVKNLNSENEQLQEHCAMAIYQCA--EDKETRDLVRL 712

  Fly   461 IGTVTALALAAMRNRSEN--TLKAILSALWNLSAHCSTNK------AEFCAVDGALAFLVGMLSY 517
            .|.:.  .||::.|.::|  .|.|:..|:|.    ||.:|      .|:.|::    .|||:|: 
Human   713 HGGLK--PLASLLNNTDNKERLAAVTGAIWK----CSISKENVTKFREYKAIE----TLVGLLT- 766

  Fly   518 EGPSKTL-----------------KIIENAGGI--------------LRNVSSHIAVC--EP--- 546
            :.|.:.|                 .|:...|||              |.||:..:..|  ||   
Human   767 DQPEEVLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESM 831

  Fly   547 -----------YRQILRQHNCLAILLQQLKSESLTVVSNSCGTLWNLSARSAEDQKFLWDNGAVP 600
                       |..::|.|..|.:|   ..|:....|......|.|......:..:.||      
Human   832 MWGLTLSSRLKYSGMMRGHCSLKLL---GSSDPPNFVFFRSRKLRNRIIDRLDGVRLLW------ 887

  Fly   601 MLRSLIHSKHAMISEGSSSALKNLLNFRPAVQNHHQLDPIARSM--GLKALPTLEARKAKALQQE 663
               ||:.:.|..:...::.||      .|.::|......:.||.  ||:.:..|    .|:..:|
Human   888 ---SLLKNPHPDVKASAAWAL------CPCIKNAKDAGEMVRSFVGGLELIVNL----LKSDNKE 939

  Fly   664 LGERHTAETCDNLDTGGKLDKERASSSSRRHPAPRLTRSAMLTKSESRDSVYSAKSDCAYDHLIR 728
            :    .|..|..:....| |:|..:..:.....|.|::.|....::.|..:..|.|.|..  ..|
Human   940 V----LASVCAAITNIAK-DQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCM--WGR 997

  Fly   729 SASASDAHRKVKPKITDFDLEMEQDTEATEE------QPIDYSVKYSENATKTSTYQETD----- 782
            :..|...|:.|.|.:............||.:      :..|..:...||....:|.:|.|     
Human   998 NRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKATQREDDEDEDL 1062

  Fly   783 LDQPTDFSLRYAENQIES-DLDISGPAGGQKSTI 815
            .|.|...:|..  :.:.| |.|:...|.|..|.|
Human  1063 YDDPLPLNLLL--DMVGSPDQDLQEAAAGCISNI 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApcNP_001263046.1 ARM 222..316 CDD:237987 22/100 (22%)
armadillo repeat 258..332 CDD:293788 16/77 (21%)
ARM 332..448 CDD:237987 24/120 (20%)
armadillo repeat 369..403 CDD:293788 7/38 (18%)
armadillo repeat 411..448 CDD:293788 8/36 (22%)
armadillo repeat 498..539 CDD:293788 16/77 (21%)
ARM 506..624 CDD:237987 32/164 (20%)
armadillo repeat 548..582 CDD:293788 7/33 (21%)
armadillo repeat 590..624 CDD:293788 7/33 (21%)
APC_crr 837..860 CDD:283553
APC_crr 903..927 CDD:283553
APC_crr 1066..1090 CDD:283553
APC_crr 1247..1271 CDD:283553
ODAD2XP_024303817.1 PLN03200 <449..684 CDD:331927 52/269 (19%)
armadillo repeat 454..479 CDD:293788 3/24 (13%)
armadillo repeat 489..521 CDD:293788 6/36 (17%)
armadillo repeat 528..564 CDD:293788 9/38 (24%)
armadillo repeat 571..617 CDD:293788 11/51 (22%)
PLN03200 <625..>823 CDD:331927 47/229 (21%)
armadillo repeat 627..659 CDD:293788 7/34 (21%)
armadillo repeat 665..702 CDD:293788 8/39 (21%)
armadillo repeat 710..741 CDD:293788 8/32 (25%)
armadillo repeat 749..785 CDD:293788 8/40 (20%)
armadillo repeat 876..908 CDD:293788 7/46 (15%)
HEAT_2 885..990 CDD:316194 26/128 (20%)
armadillo repeat 926..951 CDD:293788 6/32 (19%)
armadillo repeat 958..995 CDD:293788 7/38 (18%)
armadillo repeat 999..1030 CDD:293788 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.