DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apc and Apc2

DIOPT Version :10

Sequence 1:NP_477152.1 Gene:Apc / 44642 FlyBaseID:FBgn0015589 Length:2417 Species:Drosophila melanogaster
Sequence 2:NP_477430.1 Gene:Apc2 / 42871 FlyBaseID:FBgn0026598 Length:1067 Species:Drosophila melanogaster


Alignment Length:326 Identity:66/326 - (20%)
Similarity:97/326 - (29%) Gaps:126/326 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YQNQRLRQNYQRRSATSGVAAFAAGDNIAT-----------------------GTILKDPAVEGY 97
            :|::.|....:||:..||... :||..:.|                       .|:::|    |.
  Fly    36 HQSEYLAARDERRAFVSGFDG-SAGTAVVTEREALLWTDGRYYQQATKQLDTNWTLMRD----GQ 95

  Fly    98 PSVQSFADAYPADALPENEIPLSDDGGQLEQDGN----------------AGGELDFALDNEEPL 146
            ||..|. ||:.|.||        ..|.::..|.|                ||..|...:.|...|
  Fly    96 PSTPSI-DAWLAKAL--------QPGARVGVDANLITAAAWMPLQTSLKTAGCTLLPVVPNLIDL 151

  Fly   147 --EDVPAVAAAPLVPTTT-------------------DKRKKKVTVQLDSASAE----------- 179
              ::.|||...||:|..|                   |||...:.|   ||..|           
  Fly   152 LWKEQPAVPHNPLLPLATTFTGATIAQKLATVREKLADKRASVLVV---SALDEIAWLLNLRGTD 213

  Fly   180 ----------------------DDQEDEEQVSFGTRRGGSAGRPAGGSAGPMFPVTFGSTNGGAI 222
                                  |..:...||....|..|......|          :|..:....
  Fly   214 IDYNPVFFAYVIVTPDALYLFIDPAQMRPQVEDHFRANGVTVEVRG----------YGEVHAVLQ 268

  Fly   223 AIANSYSTGKGGSAT------SHATAYGSPASVPEERRRAVVLQQQKQHQQQQQQQQRSIRPAKL 281
            .:|.:.||....|.|      |..::|...|.||||||...:.........:.:.:.:.||...:
  Fly   269 ELAGNSSTSATPSGTRPLVWISSGSSYALVALVPEERRLNDITPINLMKAVKNETEAKGIRDCHV 333

  Fly   282 R 282
            |
  Fly   334 R 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApcNP_477152.1 ARM 251..293 CDD:214547 7/32 (22%)
armadillo repeat 258..332 CDD:293788 3/25 (12%)
APC_rep 294..360 CDD:465870
armadillo repeat 369..403 CDD:293788
armadillo repeat 411..448 CDD:293788
armadillo repeat 498..539 CDD:293788
Arm 544..584 CDD:425727
armadillo repeat 548..582 CDD:293788
armadillo repeat 590..624 CDD:293788
APC_15aa 757..771 CDD:461790
APC_r 903..926 CDD:461781
APC_r 1066..1089 CDD:461781
APC_r 1247..1270 CDD:461781
Herpes_BLLF1 <2239..>2413 CDD:282904
Apc2NP_477430.1 ARM 23..66 CDD:214547 9/30 (30%)
armadillo repeat 29..64 CDD:293788 8/28 (29%)
APC_rep 69..133 CDD:465870 14/76 (18%)
armadillo repeat 72..124 CDD:293788 14/64 (22%)
armadillo repeat 139..176 CDD:293788 10/36 (28%)
armadillo repeat 186..223 CDD:293788 7/39 (18%)
armadillo repeat 273..314 CDD:293788 13/40 (33%)
Arm 319..359 CDD:425727 3/16 (19%)
armadillo repeat 323..357 CDD:293788 3/12 (25%)
Arm 361..400 CDD:425727
armadillo repeat 365..399 CDD:293788
APC_15aa 497..511 CDD:461790
APC_r 596..618 CDD:461781
APC_r 737..760 CDD:461781
APC_r 784..807 CDD:461781
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.