DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apc and Odad2

DIOPT Version :9

Sequence 1:NP_001263046.1 Gene:Apc / 44642 FlyBaseID:FBgn0015589 Length:2417 Species:Drosophila melanogaster
Sequence 2:XP_038952403.1 Gene:Odad2 / 307036 RGDID:1306933 Length:1073 Species:Rattus norvegicus


Alignment Length:873 Identity:163/873 - (18%)
Similarity:291/873 - (33%) Gaps:324/873 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EQLKMDKKYERDGE---------VSDYELAASGYTKKEFTQ-------------DDNTLHFTQSA 97
            :.:::.|::...||         .||||. ::|.....:.|             |..||..|.|.
  Rat   238 KDIELLKRFSGKGEQTVLEWIEYTSDYEF-SNGCRAPPWRQIQGEMCYVMVKPHDVETLCLTCST 301

  Fly    98 VG--LGSGAVGKKPAAKH-------------FLDENPIPPDYMLAQELREMREHRSLDRNFERQS 147
            .|  |..|...::.|..:             ..|::|:..:.|..||:|           |..:.
  Rat   302 EGVFLNGGKTEEEGAIDYERKGEVYKDIVTCLKDQSPVFSENMSKQEIR-----------FNEEQ 355

  Fly   148 AQQQQLDELPPRNGGGSPASAGRPSRSKEPSYTLSRFLDGDAPAPAPRLPKGAAWTTSFD----- 207
            .:..|:.|.|....|.|.|:....|:.::..:..|..        ..||.....|..:.|     
  Rat   356 QKDSQIFEKPKTEDGPSSATGSEKSKVEKLYFGKSHM--------TKRLEPSLNWRATVDYKDHK 412

  Fly   208 --------------ERYTSSA--------------VEATL------------------------- 219
                          |:.::|.              ||.|:                         
  Rat   413 SSTKDSQEEKQGKLEKSSTSVSTGRGQLLRKGGEKVEETVSESSSESEEDEEPLDHRQEANADLP 477

  Fly   220 ---------------GSKVECVYSLLSMLGSN---DPLEMA------------------------ 242
                           |::...|.:|.||...|   :..::|                        
  Rat   478 SEYWQIQKLVKYLKGGNQTATVIALCSMRDFNLAQETCQLAIRDVGGLEVLINLLDTDEVKCKIG 542

  Fly   243 --KKFLELSGNAQSCATLRRS----GCMPLLVQMMHAPDNDQEVRKC-AGQALHNVVHSHPDEKA 300
              |...|:|.|.|    :||:    |.:|::|.::   |:..:..|| |.:.:.||.......:|
  Rat   543 SLKILKEISHNPQ----IRRNIVDLGGLPIMVNIL---DSSHKSLKCLAAETIANVAKFKRARRA 600

  Fly   301 GRRE---AKVLRLLDQIVDYCSFLKTLLQSGGE----AIADDSDRHPLAAISSLMKVSFDEEH-- 356
            .|:.   .|::.|||     |.      |:..|    .:.:..|.. :|...:|...|..:.|  
  Rat   601 VRQHGGITKLVALLD-----CG------QNSSEPAQPGLYETRDVE-VARCGALALWSCSKSHSN 653

  Fly   357 RHAMCELGALHAIPNLVHLDH-----AVHGPKPEDQCCNSLRRYALMALTNLTFGDENNKALLCG 416
            :.|:.:.|.:..:..|:...|     .|.|...|   |.|               :||.:|.:..
  Rat   654 KEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQE---CAS---------------EENYRAAIKA 700

  Fly   417 QKQFMEALVAQLDSAPDDLLQVTASVLRNLSWRADSNMKAVLNEIGTVTALALAAMRNRSEN--T 479
            :: .:|.||..|:|..:.|.:..|..:...:  .|...:.::...|.:.  .||::.|.::|  .
  Rat   701 ER-IIENLVKNLNSENEQLQEHCAMAIYQCA--EDEETRDLVRLHGGLK--PLASLLNNTDNKER 760

  Fly   480 LKAILSALWNLSAHCSTNK------AEFCAVDGALAFLVGMLSYEGPSKTL-------------- 524
            |.|:..|:|.    ||.:|      .|:.|::    .|||:|: :.|.:.|              
  Rat   761 LAAVTGAIWK----CSISKENVIKFREYKAIE----TLVGLLT-DQPEEVLVNVVGALGECCQEY 816

  Fly   525 ---KIIENAGGI--------------LRNVSSHIAVC--EP---------------YRQILRQH- 554
               .::...|||              |.||:..:..|  ||               :..:...| 
  Rat   817 ENRVLVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMAIIDRLDGVRLLWSLLKNPHP 881

  Fly   555 -----------NC-----------------LAILLQQLKSESLTVVSNSCGTLWNLSARSAEDQK 591
                       .|                 |.:::..|||::..|:::.|..:.|: |:..|:..
  Rat   882 DVKASAAWALCPCIENAKDAGEMVRSFVGGLELVVNLLKSDNKEVLASVCAAITNI-AKDQENLA 945

  Fly   592 FLWDNGAVPMLRSLIHSKHAMISEGSSSALKNLLNF---RPAVQNHHQLDPIARSMGLKALPT-L 652
            .:.|:|.||:|..|.::.:..:....:.|:.....:   |.|...|..:.|:.|.  ||:..| :
  Rat   946 VITDHGVVPLLSKLANTNNDKLRRHLAEAISRCCMWGRNRVAFGEHKAVAPLVRY--LKSNDTNV 1008

  Fly   653 EARKAKALQQELGERHTAETCDNLDTGG 680
            ....|:||.| |.|  .|:.|..:...|
  Rat  1009 HRATAQALYQ-LSE--DADNCITMHENG 1033

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApcNP_001263046.1 ARM 222..316 CDD:237987 28/130 (22%)
armadillo repeat 258..332 CDD:293788 20/85 (24%)
ARM 332..448 CDD:237987 24/122 (20%)
armadillo repeat 369..403 CDD:293788 7/38 (18%)
armadillo repeat 411..448 CDD:293788 8/36 (22%)
armadillo repeat 498..539 CDD:293788 15/77 (19%)
ARM 506..624 CDD:237987 33/194 (17%)
armadillo repeat 548..582 CDD:293788 8/62 (13%)
armadillo repeat 590..624 CDD:293788 7/33 (21%)
APC_crr 837..860 CDD:283553
APC_crr 903..927 CDD:283553
APC_crr 1066..1090 CDD:283553
APC_crr 1247..1271 CDD:283553
Odad2XP_038952403.1 PLN03200 <478..713 CDD:215629 53/272 (19%)
armadillo repeat 483..508 CDD:293788 5/24 (21%)
armadillo repeat 518..550 CDD:293788 2/31 (6%)
armadillo repeat 557..593 CDD:293788 11/38 (29%)
PLN03200 <599..>891 CDD:215629 64/335 (19%)
armadillo repeat 600..646 CDD:293788 12/57 (21%)
armadillo repeat 656..688 CDD:293788 7/34 (21%)
armadillo repeat 694..731 CDD:293788 8/39 (21%)
armadillo repeat 736..769 CDD:293788 8/34 (24%)
armadillo repeat 778..814 CDD:293788 8/40 (20%)
SRP1 <786..1071 CDD:227396 51/259 (20%)
armadillo repeat 859..896 CDD:293788 2/36 (6%)
armadillo repeat 912..937 CDD:293788 6/24 (25%)
armadillo repeat 944..1021 CDD:293788 20/79 (25%)
HEAT repeat 955..983 CDD:293787 3/27 (11%)
armadillo repeat 1027..1060 CDD:293788 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.