DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apc and ankar

DIOPT Version :9

Sequence 1:NP_001263046.1 Gene:Apc / 44642 FlyBaseID:FBgn0015589 Length:2417 Species:Drosophila melanogaster
Sequence 2:XP_031749763.1 Gene:ankar / 100496722 XenbaseID:XB-GENE-1010351 Length:1400 Species:Xenopus tropicalis


Alignment Length:788 Identity:149/788 - (18%)
Similarity:284/788 - (36%) Gaps:252/788 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 EMAKKFLELSGNAQSCATLR-------RSGCMPLLVQMMHAPDNDQEVRKC-AGQALHNVVHSHP 296
            |||.:.||:     .|...|       ::|.:|.||:::|   :||...|| |...|.|:.:::|
 Frog   737 EMAVRCLEV-----LCVVNRNYWEDIYKAGTIPSLVELLH---SDQVPLKCLALGILSNISNNNP 793

  Fly   297 DEKAGRREAKVLRLLDQIVDYCSFLKTLLQSGGEAIADDSDRHPLAAISSLMKVSFDEEHRHAMC 361
            ..:|                       |::||                                 
 Frog   794 VSRA-----------------------LVKSG--------------------------------- 802

  Fly   362 ELGALHAIPNLVHLDHAVHGPKPEDQC-CNSLRRYALMALTNLTFGDENNKALLCGQKQFMEALV 425
                  ||..||||   :|..:||.|. |:.|       |:::...|.|...:  .:...:..||
 Frog   803 ------AIQVLVHL---LHSRQPELQSRCSVL-------LSDIAQIDSNQNVI--AEMDGISPLV 849

  Fly   426 AQLDSAPDDLLQVTASVLRNLSWRADSNMKAVLNEIGTVTALALAAMRNRSENTLKAILSALWNL 490
            ..|....:|:|....:.:|.|..:..:|.||| .::|.:.:| :..:..:|:..:.|....:..|
 Frog   850 HLLYEKYEDVLVNAVNCIRVLCIKNTANQKAV-RDLGAIPSL-VEFLTAKSDILVSAATDVIAEL 912

  Fly   491 SAHCSTNKAEFCAV--DGALAFLVGMLSYEGPSKTLKIIENAGGILRNVSSHI-------AVCEP 546
            :   ..|||...||  :|.:..|:.:|.                 :||::..:       |:|:.
 Frog   913 A---RDNKAIQDAVTKEGVIESLISILR-----------------VRNINIQVKAAMTIEALCDH 957

  Fly   547 YRQILRQHNCLAI---LLQQLKSESLTVVSNSCGTLWNLSARSAEDQKFLWDN------------ 596
            ...:.::....::   :.:.||...|.|......|||.|:.::.:.||.:.:.            
 Frog   958 NPAVQKEFLTKSVTKHISKLLKVFQLEVREQGSTTLWALAGQTRKQQKAMAEYIGYKCIIDMLLS 1022

  Fly   597 --------GAVPMLRSLIHSKH--AMISEGSS-SALKNLLNFRPAVQNHHQLDPIARSMGLKALP 650
                    |...::.....|:|  ..|.||:. ..|..||. .|.|.| ..|..|.:::|:..:.
 Frog  1023 PSDKMQYIGGEAIIALCKDSRHYQCQICEGNGIGPLVRLLR-SPKVAN-GTLIRIIKALGIMCIG 1085

  Fly   651 TLEARKAKALQQELGERHTAETCDNLDTGGKLDKERASSSSRRHPAPRLTRSAMLTKSESRDSVY 715
            ........| |:::.|.:...|..:|                     ..|::::..|:|     .
 Frog  1086 VAFINNPVA-QEKIVEENAIPTLLHL---------------------LKTQNSLHVKAE-----V 1123

  Fly   716 SAKSDCAYDHLIRSASASDAHRKVKP-KITD-FDLEMEQDTEATEEQPIDYSVKYSENA-TKTST 777
            :....|.   ::|:::..|:.::::. |.:| .||....|      :.|.....|:.:. ..:||
 Frog  1124 ACTLACI---VLRNSNLQDSLKEMEDVKYSDILDLLYASD------KAICLRAGYALSLFAYSST 1179

  Fly   778 YQETDLDQPTDFSLRYAENQIESDLDISGPAGGQKSTITPP---AETVPEKSEGQEILLIL---- 835
            .|:.::          .||            ||.|.:|..|   ::..||::.....:::|    
 Frog  1180 MQQFNI----------LEN------------GGIKISIYEPFLQSDIEPERALAAFQIVVLAKVI 1222

  Fly   836 ---DDSVKCYQTEDTPYVISNAASVTDLRVAAKADAE-AEVKPEVREVTSKEGAPKKLPKLSQCG 896
               |....|.:.......:..:.:.|.|.:..:..|. |.::..:.|..:..|..|.|     | 
 Frog  1223 SDMDQITLCTKGVTVLTELLQSKNPTTLVLTGELLATLAHIRTGIPEAITTLGTVKCL-----C- 1281

  Fly   897 SGSYTPEKPINYCEEGTPGY--FSRYDS-----------------LSSLDESGKANQAIVGTDAD 942
            :..|:|::.:........||  |:|..|                 :|:|.|..:.::..  ||  
 Frog  1282 NHLYSPDEEVRIACANALGYLTFNRTASRHLLAECRTRPCLYNLLISNLSEDARMSKTF--TD-- 1342

  Fly   943 IKPKLEKQ 950
             :.|::||
 Frog  1343 -EFKIQKQ 1349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApcNP_001263046.1 ARM 222..316 CDD:237987 21/83 (25%)
armadillo repeat 258..332 CDD:293788 18/81 (22%)
ARM 332..448 CDD:237987 22/116 (19%)
armadillo repeat 369..403 CDD:293788 12/34 (35%)
armadillo repeat 411..448 CDD:293788 7/36 (19%)
armadillo repeat 498..539 CDD:293788 9/42 (21%)
ARM 506..624 CDD:237987 24/150 (16%)
armadillo repeat 548..582 CDD:293788 7/36 (19%)
armadillo repeat 590..624 CDD:293788 9/56 (16%)
APC_crr 837..860 CDD:283553 2/22 (9%)
APC_crr 903..927 CDD:283553 6/42 (14%)
APC_crr 1066..1090 CDD:283553
APC_crr 1247..1271 CDD:283553
ankarXP_031749763.1 ANKYR <530..641 CDD:223738
ANK repeat 537..586 CDD:293786
Ank_2 593..688 CDD:403870
ANK repeat 621..655 CDD:293786
ANK repeat 657..688 CDD:293786
PLN03200 <722..>1011 CDD:215629 77/377 (20%)
armadillo repeat 722..746 CDD:293788 5/13 (38%)
armadillo repeat 756..788 CDD:293788 11/34 (32%)
armadillo repeat 796..831 CDD:293788 17/106 (16%)
armadillo repeat 836..870 CDD:293788 6/35 (17%)
armadillo repeat 878..912 CDD:293788 7/35 (20%)
armadillo repeat 920..954 CDD:293788 7/50 (14%)
armadillo repeat 962..996 CDD:293788 7/33 (21%)
armadillo repeat 1014..1038 CDD:293788 1/23 (4%)
armadillo repeat 1046..1084 CDD:293788 12/39 (31%)
armadillo repeat 1095..1130 CDD:293788 7/60 (12%)
armadillo repeat 1185..1218 CDD:293788 9/54 (17%)
armadillo repeat 1235..1260 CDD:293788 3/24 (13%)
armadillo repeat 1268..1304 CDD:293788 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.