DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cutlet and CG31955

DIOPT Version :9

Sequence 1:NP_787969.1 Gene:cutlet / 44637 FlyBaseID:FBgn0015376 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_001285597.1 Gene:CG31955 / 319045 FlyBaseID:FBgn0051955 Length:153 Species:Drosophila melanogaster


Alignment Length:107 Identity:24/107 - (22%)
Similarity:37/107 - (34%) Gaps:40/107 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 DDVSRLKALHDFKM-------------------RNLSYEIPNWPFLAIQRSDLERIYVRFHSEDY 261
            ||...:..:.|.|:                   |.||..||.:|. |::..:..|:|.  :||..
  Fly    20 DDEKHVSHMPDSKLSVRNILDSAYASAEGKIITRKLSRSIPPYPH-AVRVKNGIRVYE--YSEPR 81

  Fly   262 EQRQLDLISARGEVVGSLLGEAKDKIWQEAGEIVLSRATAAE 303
            :|                  ..|..:|:||..|:..|...||
  Fly    82 KQ------------------SYKSSLWKEAYNILHQRLDIAE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cutletNP_787969.1 AAA 424..555 CDD:99707
CG31955NP_001285597.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1969
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.