DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and ERG5

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_013728.1 Gene:ERG5 / 855029 SGDID:S000004617 Length:538 Species:Saccharomyces cerevisiae


Alignment Length:452 Identity:88/452 - (19%)
Similarity:174/452 - (38%) Gaps:97/452 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FRYW--IGYYSNIMVTNPKYMEF------------------------------ILSSQTLISKSD 103
            |::|  ||.:...:  :||:.|:                              ||.|...: |..
Yeast    76 FKFWPIIGPFLESL--DPKFEEYKAKWASGPLSCVSIFHKFVVIASTRDLARKILQSSKFV-KPC 137

  Fly   104 VYD----LTHP--WLGLGLLTSTGSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKKVA 162
            |.|    :..|  |:.|     .|.....:||.:...|....|..:...:.:...|::|:..:::
Yeast   138 VVDVAVKILRPCNWVFL-----DGKAHTDYRKSLNGLFTKQALAQYLPSLEQIMDKYMDKFVRLS 197

  Fly   163 DGGNIFDFQEEAHYLTLDVICDTAMGVSINAM------ENRSSSVVQAFKDITYTIKMRAFSPWK 221
            ...| ::.|...|.:. :::|    .:|:|:.      |::...:...:..:|..:::..|    
Yeast   198 KENN-YEPQVFFHEMR-EILC----ALSLNSFCGNYITEDQVRKIADDYYLVTAALELVNF---- 252

  Fly   222 RNKYLFHFAPEYPEYSKTL--KTLQDFTNEIIAKRIEVRKSGLEVGIKADEFSRKKMAFLDTLL- 283
                     |....|:||.  |...|...:|.....::.|..:..|       .|.:..:|... 
Yeast   253 ---------PIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAG-------GKPVCVMDAWCK 301

  Fly   284 -----------SSKVDGRPLTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQ 337
                       .|::..|..|::|:.|.|.||:|...|.::|...:...:::..||...|:..||
Yeast   302 LMHDAKNSNDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQ 366

  Fly   338 CDVMGASGLGRDATFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDYVIDGD-IVPKGTTLNL 401
            ..|.. :.:..:.....|..||:.::.|||..|..|.|..:....:|::.:..: ..|||..|..
Yeast   367 LAVRN-NDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLIP 430

  Fly   402 GLLMLGYNDRVFKDPHKFQPERF---DREKPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSK 460
            .|....::..|:::|.:|.|||:   .:.......::.|..||..|:||.:.::....::.|
Yeast   431 TLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGK 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 88/452 (19%)
ERG5NP_013728.1 CYP61_CYP710 103..522 CDD:410703 81/423 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I1557
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I1313
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.