DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and CYP86A7

DIOPT Version :10

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_176558.1 Gene:CYP86A7 / 842675 AraportID:AT1G63710 Length:523 Species:Arabidopsis thaliana


Alignment Length:72 Identity:13/72 - (18%)
Similarity:31/72 - (43%) Gaps:4/72 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HVATTQSQSYEDKRCKCICPSFKTADNTTQEGTDRMLI----IDNVPPNKCNCDGVILPRLVGKI 76
            |:....|::..|..|.....:.::.|:......:.:|:    |::...:|.....::..:::|.|
plant   349 HIEVNDSRTNHDDDCVITVTATESPDDLKSMAVEAVLLLQEKINDEDEDKVKMQLLVSSKVIGCI 413

  Fly    77 KGKGQEI 83
            .||...|
plant   414 IGKSGSI 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 CYP4 68..520 CDD:410721 5/16 (31%)
CYP86A7NP_176558.1 CYP86A 67..500 CDD:410687 13/72 (18%)

Return to query results.
Submit another query.