DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and CYP71A18

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001184964.1 Gene:CYP71A18 / 837705 AraportID:AT1G11610 Length:504 Species:Arabidopsis thaliana


Alignment Length:500 Identity:102/500 - (20%)
Similarity:201/500 - (40%) Gaps:77/500 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWIVLCAFLALPLFLVTYFELGLLRRKRMLNKFQGPSMLPLVGNAHQMGNTPTEILNRFFGWWHE 65
            :.:.||....|.|.|:..|   |.|..:.:|....|..:|::||.||:...|...|:..      
plant     5 LMVSLCLTTLLTLLLLKKF---LKRTAKKVNLPPSPWRIPVIGNLHQLSLHPHRSLHSL------ 60

  Fly    66 YGKDNFRY------WIGYYSNIMVTNPKYMEFILSSQTL-ISKSDVYDLTHPWLGLG---LLTST 120
                :.||      ..|....::|::.:....||.:..| .:........|..:..|   :....
plant    61 ----SLRYGPLMLLHFGRVPILVVSSSEAAHEILKTHDLKFANRPKSKAVHGLMNGGRDVVFGPY 121

  Fly   121 GSKWHKHRKMITPAFHFNILQD-----FHEVMNENSTKFIDQLKKVADGGNIFDFQEEAHYLTLD 180
            |..|.:.:.:..    .|:|.:     |.:|..|.....:::|:|.:...:..:..|....||.|
plant   122 GEYWRQMKSVCI----LNLLTNKMVASFEKVREEEVNAMMEKLEKASCSSSAENLSELFVTLTSD 182

  Fly   181 VICDTAMGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYP--EYSKTLKTL 243
            |....::|...  .|:.::..::                 ||.:.:.....|:|  :|...|..:
plant   183 VTSRVSLGKKY--WEDETAGGLK-----------------KRVRQIMELLREFPIGDYVPALAWI 228

  Fly   244 QDFTNEIIAKRIEVRKSGLEVGIKAD----EFSRKKMAFLDTLLS---SKVDGRPLTSQELYEEV 301
             |..|...:|.:||.::..::..|..    |....|..|::.|||   .|.:|..:...::...:
plant   229 -DRINGFNSKIVEVSRAYSDLMEKVVQEHLEAGEHKADFVNILLSIEKEKNNGFKVQRNDIKFMI 292

  Fly   302 STFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRDATF---QEISTMKHLDL 363
            ......|..|:::.:.:.:..|.|:|:..:||.||....:...|     ::   :|:..|::|..
plant   293 LDMFIGGISTSSTLLEWIMTELIRNPECMKKLQNEIRSTIRPHG-----SYIKEKEVENMRYLKA 352

  Fly   364 FIKEAQRLYPSVPFI-GRFTEKDYVIDGDIVPKGTTLNLGLLMLGYNDRVF-KDPHKFQPER--- 423
            .|||..|::|.:|.| .|...:|..:.|..:..||.:.:....:..:..:: .|..:|:|||   
plant   353 VIKEVFRVHPPLPLILPRLLTEDVKVKGYDIAAGTEVLINAWSIHRDPAIWGPDAEEFKPERHLD 417

  Fly   424 --FDREKPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFE 466
              .|.... ..:|:||.:|.|.|.|...|:..::..::.::..|:
plant   418 STLDYHGQ-DLKYIPFGSGRRICPGINLAMGLVEVTLANLVGRFD 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 93/466 (20%)
CYP71A18NP_001184964.1 p450 26..496 CDD:299894 95/475 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.