DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and CYP702A5

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001078393.1 Gene:CYP702A5 / 827206 AraportID:AT4G15393 Length:467 Species:Arabidopsis thaliana


Alignment Length:482 Identity:99/482 - (20%)
Similarity:168/482 - (34%) Gaps:143/482 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PLVGNA------HQMGNTPTEILNR-----------FFGWWHEYGKDNFRYWIGYYSNIMVTN-- 85
            |::|..      |.....||.:..:           .||     ||......||....|..||  
plant    43 PIIGETFEFMKLHDAIQLPTFVKEKLLRHGPVFRTSLFG-----GKVIISTDIGLNMEIAKTNHI 102

  Fly    86 ---PKYMEFILSSQTLISKSDVYDLTHPWLGLGLLTSTGSKWHKHRKMIT------PAFHFNILQ 141
               ||.:|.:..:..|....|.                    |||.:.:|      .|....::|
plant   103 PGMPKSLERLFGATNLFVNKDT--------------------HKHARSLTNQFLGSQALKLRMIQ 147

  Fly   142 DFHEV----MNENSTKFIDQLKKVADGGNIFDFQEEAHYLTLDVICDTAMGVSINAMENRSSSVV 202
            |...:    |.|.:.|            ...|.:|.|..:.::.:....||    .||      .
plant   148 DIDFLARTHMKEGARK------------GCLDVKETASKIVIECLSKKVMG----EME------P 190

  Fly   203 QAFKDIT--YTIKMRAFSP--WKRNKYLFHFAPEYP-----EYSKTLKTLQDFTNEIIAKRIEVR 258
            :|.|::|  :|     |.|  |      |.||..:|     ...|....:.....|.:.|:   |
plant   191 EAAKELTLCWT-----FFPRDW------FRFAWNFPGTGVYRIVKARNRMMKVIKETVVKK---R 241

  Fly   259 KSGLEVGIKADEFSRKKMAFLDTLLSSKVDGRPLTSQELYEEVSTFMFEGHDTTTSGVGFAVYLL 323
            .||.::|           .|.:|:... .:...::.:...|.:.|.....::||...:...:.|:
plant   242 ASGKKLG-----------EFFETIFGD-TESVTMSIEIATEYIFTLFVLANETTPGVLAATIKLI 294

  Fly   324 SRHPDEQEKLFNEQCDVMGASGLGR---------DATFQEISTMKHLDLFIKEAQRLYPSVPFIG 379
            |.:|...::|..|.      .|:.:         |.|:::..:|....:.|.|:.|:..:||.:.
plant   295 SDNPKVMQELRREH------EGIVQDKIKKDETADLTWEDYKSMTFTQMVINESLRITSTVPTVL 353

  Fly   380 RFTEKDYVIDGDIVPKGTTLNLGLLMLGY-----NDRVFKDPHKFQPERF---DREKPGPFEYVP 436
            |      :||.:|.....|:..|.:.:||     |...:.||..|.|.|:   |........|:|
plant   354 R------IIDHEIQFGDYTIPAGWIFMGYPYVHFNPEKYDDPLAFNPWRWKGKDLSTIVSKTYLP 412

  Fly   437 FSAGPRNCIGQKFALLEIKTVVSKIIR 463
            |.:|.|.|:|.:|..|::...:..:.|
plant   413 FGSGTRLCVGAEFVKLQMAIFIHHLFR 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 99/482 (21%)
CYP702A5NP_001078393.1 p450 30..448 CDD:386267 99/482 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.