DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and CYP94C1

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_180337.1 Gene:CYP94C1 / 817315 AraportID:AT2G27690 Length:495 Species:Arabidopsis thaliana


Alignment Length:505 Identity:126/505 - (24%)
Similarity:213/505 - (42%) Gaps:93/505 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HQMGNTPTEILNRFFGWWHEYGKDNFRYWIGYYSNIMVTNPKYMEFILSS---------QTLISK 101
            |.:..:||..:.                 :...::::..||..:|.||.:         |..:..
plant    58 HLLRRSPTSTIK-----------------VHVLNSVITANPSNVEHILKTNFHNYPKGKQFSVIL 105

  Fly   102 SDVYDLTHPWLGLGLLTSTGSKWHKHRKMITPAFHFNILQDF-HEVM-NENSTKFIDQLKKVADG 164
            .|:       ||.|:..|.|..|...||:.:.......::.| ||:: .|..|:.:..|...:|.
plant   106 GDL-------LGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKTEIETRLLPILTSFSDN 163

  Fly   165 -GNIFDFQEEAHYLTLDVICDTAMGVSINAME--NRSSSVVQAFKDITYTIKMRAFSP----WKR 222
             |::.|.|:.....:.|.|...:.|...:.:.  ...|....||...:.....||.:|    || 
plant   164 PGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPFPISEFAVAFDTASLLSAKRALAPFPLLWK- 227

  Fly   223 NKYLFHFAPEYPEYSKTLKTLQDFTNEIIAKRIEVRKSGLEVGIKADEFSRKKMAFLDTLLSSKV 287
            .|.|.....| .:..:::..:.....::|.:|   |.:|| :| |.|..||    |:..:...  
plant   228 TKRLLRIGSE-KKLQESINVINRLAGDLIKQR---RLTGL-MG-KNDLISR----FMAVVAED-- 280

  Fly   288 DGRPLTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRDATF 352
                 ..:.|.:.|.:|:..|.||..:|:....:||:|||:.:.::..|...|||.......|..
plant   281 -----DDEYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPEVENRIREELDRVMGTGFDSVTARC 340

  Fly   353 QEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDYVI-DGDIVPKGTTLNLGLLMLGYNDRVF-KD 415
            .|:..|.:|...:.|:.||:|.|.|..:|...|.|: ||..|..||.:......:|..||:: .|
plant   341 DEMREMDYLHASLYESMRLFPPVQFDSKFALNDDVLSDGTFVNSGTRVTYHAYAMGRMDRIWGPD 405

  Fly   416 PHKFQPERF-DRE---KP-GPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALDELV 475
            ..:|:|||: |.|   :| .|.:|..|.||.|.|||::.|::|:|::...|||.||...|..|  
plant   406 YEEFKPERWLDNEGKFRPENPVKYPVFQAGARVCIGKEMAIMEMKSIAVAIIRRFETRVASPE-- 468

  Fly   476 SKDGYISTTLGLQPAEKKSRDAHNHKYDPILSASMTLKSENGLHLRMKQR 525
                   ||..|             ::.|.|:|::    ..||.:.:::|
plant   469 -------TTETL-------------RFAPGLTATV----NGGLPVMIQER 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 115/447 (26%)
CYP94C1NP_180337.1 PLN02426 23..495 CDD:215235 126/505 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.