DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and CYP4F11

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001122404.1 Gene:CYP4F11 / 57834 HGNCID:13265 Length:524 Species:Homo sapiens


Alignment Length:497 Identity:149/497 - (29%)
Similarity:256/497 - (51%) Gaps:61/497 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HQMGNTPTE----ILNRFFGWWHEYGKDNFRYWIG-YYSNIMVTNPKYMEFILSSQTLISKSDV- 104
            ||...||||    .|.:....:.:    .|:.|:| .:..:::.:|..:..|.|:...::..|: 
Human    63 HQGLVTPTEEGMKTLTQLVTTYPQ----GFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMI 123

  Fly   105 -YDLTHPWLGLGLLTSTGSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKKVADGGNI- 167
             |....||||.|||.|.|.||.:||:|:|||||||||:.:.::.|::.....|:.:::|..|:. 
Human   124 FYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQRLASEGSAR 188

  Fly   168 FDFQEEAHYLTLDVICDTAMGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPE 232
            .|..|....:|||.:.........|..| :.|..:.|..:::..::.|.........:|::..|:
Human   189 LDMFEHISLMTLDSLQKCVFSFESNCQE-KPSEYIAAILELSAFVEKRNQQILLHTDFLYYLTPD 252

  Fly   233 YPEYSKTLKTLQDFTNEII-AKRIEVRKSGLEVGIKADEFSRKKMAFLDTLLSSK-VDGRPLTSQ 295
            ...:.:....:.|||:.:| .:|..:...|::..:| ::...|.:.|:|.||.|| .||:.|:.:
Human   253 GQRFRRACHLVHDFTDAVIQERRCTLPTQGIDDFLK-NKAKSKTLDFIDVLLLSKDEDGKELSDE 316

  Fly   296 ELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRD-----ATFQEI 355
            ::..|..||||||||||.||:.:.:|.|::||:.||:...|..:::      :|     ..:.::
Human   317 DIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELL------KDREPIEIEWDDL 375

  Fly   356 STMKHLDLFIKEAQRLYPSVPFIGRFTEKDYVI-DGDIVPKGTTLNLGLLMLGYNDRVFKDPHKF 419
            :.:..|.:.|||:.||:|.||.|.|...:|:|: ||.::|||....:.::.:.||..|:.||..:
Human   376 AQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVCLINIIGIHYNPTVWPDPEVY 440

  Fly   420 QPERFDRE---KPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALDELVSKDGYI 481
            .|.|||:|   :..|..::||||||||||||.||:.|:|.|::..:.:|.:||...|        
Human   441 DPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRILPTHTE-------- 497

  Fly   482 STTLGLQPAEKKSRDAHNHKYDPILSASMTLKSENGLHLRMK 523
                                  |.....:.|::|.||.||::
Human   498 ----------------------PRRKPELILRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 139/441 (32%)
CYP4F11NP_001122404.1 p450 52..506 CDD:365848 143/484 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154768
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.