DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and Cyp2c67

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001019890.1 Gene:Cyp2c67 / 545288 MGIID:3612288 Length:491 Species:Mus musculus


Alignment Length:526 Identity:120/526 - (22%)
Similarity:204/526 - (38%) Gaps:127/526 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLALPLFLVTYFELGLLR-RKRMLNKFQGPSMLPLVGNAH-----QMGNTPTEILNRFFGWWHEY 66
            |:.|.|.|.....|.|.| |....|...||:.||::||.|     .:|...|....       .|
Mouse     4 FVVLVLCLSFLLVLSLWRQRSARGNLPPGPTPLPIIGNYHLIDMKDIGQCLTNFSK-------TY 61

  Fly    67 GKDNFRYWIGYYSNIMVTNPKYME--FILSSQTLISKS--DVYDLTHPWLGLGLLTSTGSKWHKH 127
            | ..|..:.|....:::...:.|:  ||...:....:.  ..:|......|:|.  |.|:.|   
Mouse    62 G-PVFTLYFGSQPIVVLHGYEAMKEAFIDHGEEFSGRGRFPFFDKVTKGKGIGF--SHGNVW--- 120

  Fly   128 RKMITPAFHFNILQD-------FHEVMNENSTKFIDQLKKVADG--------------------- 164
              ..|..|..|.|::       ....:.|.:...:.:||| .:|                     
Mouse   121 --KATRVFTINTLRNLGMGKRTIENKVQEEAQWLMKELKK-TNGLPCDPQFIIGCAPCNVICSIV 182

  Fly   165 -GNIFDFQEEAHYLTLDVICDTAMGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNK---- 224
             .|.||:::: .:|:|       :|......|..||...|.|..:...|.   :.|.:.||    
Mouse   183 FQNRFDYKDK-DFLSL-------IGKVNECTEILSSPGCQIFNAVPILID---YCPGRHNKFFKN 236

  Fly   225 ------YLFHFAPEYPEYSKTLKTLQDFTNEIIAKRIEVRKSGLEVGIKADEFSRKKMAFLDTLL 283
                  ||.....|:.| |..:...:||.:..:.:|.:      |.||:..|::.:.:|.|    
Mouse   237 HTWIKSYLLEKIKEHEE-SLDVTNPRDFIDYFLIQRCQ------EKGIEHMEYTIEHLATL---- 290

  Fly   284 SSKVDGRPLTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGR 348
                             |:..:|.|.::.:|.:.||:.||.:|.....|:..|..:|:|..   |
Mouse   291 -----------------VTDLVFGGTESLSSTMRFALLLLMKHTHITAKVQEEIDNVIGRH---R 335

  Fly   349 DATFQEISTMKHLDLFIKEAQR--------LYPSVPFIGRFTEKDYVIDGDIVPKGTTLNLGLLM 405
            ....|:.:.|.:.:..:.|.||        |...|....:|  ::|     .:||||.:...|..
Mouse   336 SPCMQDRNHMPYTNAMVHEVQRYVDLGPISLVHEVTCDTKF--RNY-----FIPKGTQVMTSLTS 393

  Fly   406 LGYNDRVFKDPHKFQPERFDREKPGPFE----YVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFE 466
            :.::...|.:|..|.|..| .:..|.|:    :||||||.|.|:|:..|.:|:...::.|::||:
Mouse   394 VLHDSTEFPNPEVFDPGHF-LDDNGNFKKSDYFVPFSAGKRICVGESLARMELFLFLTTILQNFK 457

  Fly   467 VLPALD 472
            :.|.:|
Mouse   458 LKPLVD 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 109/494 (22%)
Cyp2c67NP_001019890.1 p450 30..487 CDD:278495 111/500 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.