DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and Cyp4a30b

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_006503285.1 Gene:Cyp4a30b / 435802 MGIID:3717145 Length:510 Species:Mus musculus


Alignment Length:464 Identity:136/464 - (29%)
Similarity:234/464 - (50%) Gaps:55/464 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 WI-GYYSNIMVTNPKYMEFILS-SQTLISKSDVYDLTHPWLGLGLLTSTGSKWHKHRKMITPAFH 136
            |: |.::.:::.:|.||:.||. |...:.:|  |....||:|.|||...|.||.:||:|:|||||
Mouse    87 WLWGNHARVVIYDPDYMKVILGRSDPKVVRS--YSFFAPWIGYGLLLLNGKKWFQHRRMLTPAFH 149

  Fly   137 FNILQDFHEVMNENSTKFIDQLKKVADGGNIFDFQEEAHYLTLDVICDTAM----GVSINAMENR 197
            ::||:.:..:|.::....:|:.:::.|.....:..::...:|::.:...|.    .|.:....| 
Mouse   150 YDILKPYVGIMVDSVHVMLDKWEQLVDQDCPLEIYQDISLMTMETMMKCAFSYQGSVQLEDCRN- 213

  Fly   198 SSSVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTLKTLQDFTNEIIAKRIEVRKSGL 262
            |.|.::|.:|:|:.|.:|..:.:.:|..::..:.....:....:.....|..:    |.:||:.|
Mouse   214 SKSYIKAVEDLTHLIYLRVRNGFHQNNTIYSLSSNGRSFYHACQIAHKHTERV----IRMRKAQL 274

  Fly   263 EVGIKADEFSRKK-MAFLDTLLSSKV-DGRPLTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSR 325
            :...:.::|.:|| :.|||.||.::. ||:.|:.:::..|:.|||||||:||.||:.:..|.|:.
Mouse   275 QNEAELEKFRKKKRLDFLDILLFAQTEDGKSLSDEDVRAEMDTFMFEGHNTTASGISWIFYALAT 339

  Fly   326 HPDEQEKLFNEQCDVMGASGLGRDATFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDYVI-D 389
            ||:.|::...|...::|.   |...|...:..|.:..:.||||.||||.:|...|........ |
Mouse   340 HPEHQQRCREEVKSILGN---GTSVTLNHLDQMPYTTMCIKEALRLYPPIPGASRELSSPVTFPD 401

  Fly   390 GDIVPKGTTLNLGLLMLGYNDRVFKDPHKFQPERFDREKPG----PFEYVPFSAGPRNCIGQKFA 450
            |..:|||..:.|....|.:|.|:..:...|.|.||   .||    ...::|||||.|||||::|.
Mouse   402 GCSLPKGFLVTLSFYGLHHNPRLRPNAEVFDPSRF---APGAPRQTHAFLPFSAGTRNCIGKQFT 463

  Fly   451 LLEIKTVVSKIIRNFEVLPALDELVSKDGYISTTLGLQPAEKKSRDAHNHKYDPILSASMTLKSE 515
            :.|:|..|:..:..||:||                  .|...           |||.:.:.|||:
Mouse   464 MNELKVAVALTLLRFELLP------------------DPTRV-----------PILVSKIVLKSK 499

  Fly   516 NGLHLRMKQ 524
            ||::|..|:
Mouse   500 NGIYLHTKK 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 123/407 (30%)
Cyp4a30bXP_006503285.1 p450 59..504 CDD:365848 134/458 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845143
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.