DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and Cyp313a2

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster


Alignment Length:534 Identity:140/534 - (26%)
Similarity:232/534 - (43%) Gaps:115/534 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IVLCAFLALPLFLVTYFELGLLRRKRMLNKFQGPSM--LPLVGNA--------HQMGNTPTEILN 57
            ||:...:|..|.|...|...  |||..:...|.|..  |||:||:        .:|.:..|    
  Fly     2 IVIQLLIAASLILWIRFLWS--RRKLYMLMMQLPGRMGLPLLGNSVRYLIISRGRMSSRTT---- 60

  Fly    58 RFFGWWHEYGKDNFRYWIGYYSNIMVTNPKYMEFILSSQTLISKS----DVYDLTHPWLGLGLLT 118
                :..::| ..:..|||....::..:||..|.:|:|...|::|    :...|:   :|.||||
  Fly    61 ----YMDKHG-STYMAWIGTTPIVITRDPKIAEKVLTSPFCINRSSQTTNALALS---MGYGLLT 117

  Fly   119 STGSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKKVADGGNIFDFQEEAHYLTLDVI- 182
            ..||||...||.:.|||..::|..|..:.|..:    |.|..|.|.   |..|.|...|: |:| 
  Fly   118 LQGSKWMARRKHMNPAFKHSVLLSFLPIFNAET----DLLVSVFDS---FVGQGEKDVLS-DLIR 174

  Fly   183 ------CDTAMGVSINAMEN-RSSSVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTL 240
                  ..|.:|..:...:| .:.::::.::.:.....:..|.|:.:||                
  Fly   175 WSFAIATQTTLGTDVTKDDNFENDAILKTYQSMLRLTIINIFVPFVQNK---------------- 223

  Fly   241 KTLQDFTNEIIAKRIEVRKSGLEVGIKADEFSRKKMAFLDTLLSSKVDGRP-------------- 291
                     |::|..     |||...:.|..:..||  ::.:|..|::..|              
  Fly   224 ---------IVSKLF-----GLEWLRRRDASAINKM--INNILDKKLNSNPENYCESELKTVIHR 272

  Fly   292 ---------LTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMG-ASGL 346
                     ::..||..|.|:.:....:|:...|.:|:.||:..|:.||.:|||..:... |.|:
  Fly   273 AIELFRNDEMSLMELGAECSSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGI 337

  Fly   347 GRDATFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDY-VIDGDIVPKGTTLNLGLLMLGYN- 409
              :.|..::..:.:||..:.|..||.|||||..|.|.:|. :.:|.::|||.|:::.:.....| 
  Fly   338 --EVTHTDLQQLVYLDRVLNETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNT 400

  Fly   410 DRVFKDPHKFQPERFDREK---PGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRN------- 464
            |....:..:|.||.|..||   ..|:.::|||.|.|||||.::.|:..|..:.||:||       
  Fly   401 DYWGSEAAQFNPENFLPEKIHDRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKLKTSF 465

  Fly   465 -FEVLPALDELVSK 477
             :|.|..:|.:|.|
  Fly   466 PYENLEFVDHMVIK 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 127/493 (26%)
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 125/483 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.