DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:574 Identity:123/574 - (21%)
Similarity:228/574 - (39%) Gaps:135/574 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWIVLCAFLALPLFL---VTYFELGLLRRKRMLNKFQGPSMLPLVGNAHQMGNTPTEILNRFFGW 62
            :|::|...:.|..:|   ..||      |.|.:......|..|: ||..|:     ..|...|| 
  Fly     4 IWLLLLTIVTLNFWLRHKYDYF------RSRGIPHLPPSSWSPM-GNLGQL-----LFLRISFG- 55

  Fly    63 WHEYGKDNFRYW-----------IGYY----SNIMVTNPKYMEFIL--SSQTLISKSDVYDLTHP 110
                  |.||..           :|::    ..:||.:|:.:..:|  :....:::.:..|...|
  Fly    56 ------DLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDP 114

  Fly   111 WLGLGLLTSTGSK---WHKHRKMITPAF------------HFNILQDFHEVMNENSTKFIDQLKK 160
               :|.||...:|   |.:.|:.::..|            ..::..|..:.:|.   |..|:|::
  Fly   115 ---MGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNR---KLGDRLER 173

  Fly   161 VADGGNIFDFQEEAHYLTLDVICDTAMGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKY 225
            |...|.:      ....|.||..:....:::..:....|.::...|::..|      :|.|...:
  Fly   174 VLPLGRM------CQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNT------NPRKVLDF 226

  Fly   226 L-FHFAPEYPEYSKTLKTLQDFT---NEIIAKRIEVRKSGLEVGIKADEFSRKKMAFLDTLLSSK 286
            : ..|.|::....|.....:|:.   ..::....|..|..|...::..:.||.         |:.
  Fly   227 MSVFFLPKWTGVLKPKVFTEDYARYMRHLVDDHHEPTKGDLINQLQHFQLSRS---------SNH 282

  Fly   287 VDGRP--LTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRD 349
            ....|  :.||     ....:..|.:|:::.:||.:|.|::.||.||:|.:|..:...::.   .
  Fly   283 YSQHPDFVASQ-----AGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTA---T 339

  Fly   350 ATFQEISTMKHLDLFIKEAQRLYPSVPFIGR---------FTEKDYVIDGDIVPKGTTLNLGLLM 405
            .::..:.|:.:|.:...||.||||:..|:.|         |:.:.:|  ..|||.|....:.:|.
  Fly   340 LSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHV--DFIVPPGMPAYISILG 402

  Fly   406 LGYNDRVFKDPHKFQPERFDREKP---GPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEV 467
            |..::|.:.:|..|.||||..|:.   .|..|:||.|||..|||.:..:|::|..:..|::.:.|
  Fly   403 LHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWV 467

  Fly   468 LPALDELVSKDGYISTTLGLQPAEKKSRDAHNHKYDPILSASMTLKSENGLHLR 521
                                   |...|.....:::|   .|..|:|||.::||
  Fly   468 -----------------------ETCERTVSEIRFNP---KSFMLESENEIYLR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 105/484 (22%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 109/527 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.