DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and Cyp9b1

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster


Alignment Length:515 Identity:124/515 - (24%)
Similarity:218/515 - (42%) Gaps:98/515 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AFLALPLFLVTYFELGLLRRK---RMLNKFQGPSM-----LPLVGN----AHQMGNTPTEILNRF 59
            :|:.:.|.|.|   :|||..|   .....|:|.::     .|.:||    |.|..:...:| :.|
  Fly     2 SFVEICLVLAT---IGLLLFKWSTGTFKAFEGRNLYFEKPYPFLGNMAASALQKASFQKQI-SEF 62

  Fly    60 FGWWHEYGKDNFRYWIGYYS----NIMVTNPKYMEFILSSQTLISKSDVYDL----THPWLGLG- 115
                  |.:......:|.::    .|.:.:|:          ||.|..|.|.    .|..|.:. 
  Fly    63 ------YNRTRHHKLVGLFNLRTPMIQINDPQ----------LIKKICVKDFDHFPNHQTLNIPN 111

  Fly   116 -------LLTSTGSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKK---VADGGNIF-- 168
                   |.......|...|.::||.|....:::...:|||:..:.::.||.   :|.|.|.|  
  Fly   112 ERLVNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFEL 176

  Fly   169 DFQEEAHYLTLDVICDTAMGVSINAMENRSSSVVQAFKDITYTI-KMRAFSPWKRNKYLFHF--- 229
            |.:...:.|:.|||..||.|:.:|:.::..:..        :|| |..|||   |......|   
  Fly   177 DMKVLCNKLSNDVIATTAFGLKVNSFDDPENEF--------HTIGKTLAFS---RGLPFLKFMMC 230

  Fly   230 --APEYPEYSKTLKTLQDFTN-----EIIAKRIEVRKSGLEVGIKADEFSRKKMAFLDTLLSSKV 287
              ||:...:.|.  |:.|.||     .::...::.|:.        ...:|..|  :..|:.:|.
  Fly   231 LLAPKVFNFFKL--TIFDSTNVEYFVRLVVDAMQYREK--------HNITRPDM--IQLLMEAKK 283

  Fly   288 DGRP-LTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRDAT 351
            :.:. .|..|:..:...|.|...:..::.:....|.|.|:.|.||:|:.|..:...|. .|...|
  Fly   284 ESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEAL-KGAPLT 347

  Fly   352 FQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDYVIDGDIVPK------GTTLNLGLLMLGYND 410
            :.....|.::|:.|.|:.|.:.......|...|||.:..|...|      |..:|:.:..|.:::
  Fly   348 YDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDE 412

  Fly   411 RVFKDPHKFQPERF-DREKPG--PFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEV 467
            |.|..|.:|.|||| :|.|..  |:.|:||..|||:|||.::|:::.|.::..::.|:::
  Fly   413 RFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKI 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 115/485 (24%)
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 114/477 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.