DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and Cyp4ac2

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster


Alignment Length:485 Identity:170/485 - (35%)
Similarity:271/485 - (55%) Gaps:30/485 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TYFELGLLRRKR-----MLNK--FQGPSMLPLVGNAHQMGNTPTEILNRFFGWWHEYGKDNFRYW 74
            |||.|.|.:|.|     :|..  :..||.... ||...:.|..:|.:..|........|.....|
  Fly    26 TYFILSLCKRIRTEDGSLLESKIYVAPSKTRF-GNNFDLVNFTSESIFNFMRDASAKAKGRNYLW 89

  Fly    75 IGYYSNIM-VTNPKYMEFILSSQTLISKSDVYDLTHPWLGLGLLTSTGSKWHKHRKMITPAFHFN 138
            ..:::.:. :...:..|.||.|..||:|:.:|:|..|:||.|||.||..|||..||.:||||||.
  Fly    90 YFFHAPMYNIVRAEEAEEILQSSKLITKNMIYELLKPFLGEGLLISTDQKWHSRRKALTPAFHFK 154

  Fly   139 ILQDFHEVMNENSTKFIDQLKKVADGGNI-FDFQEEAHYLTLDVICDTAMGVSINAMEN--RSSS 200
            :||.|..:..|...|.:   |.:....|: .:..:.....||:.:|:||:||.::.:..  |...
  Fly   155 VLQSFLIIFKEECNKLV---KVLHQSVNMELELNQVIPQFTLNNVCETALGVKLDDLSEGIRYRQ 216

  Fly   201 VVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTLKTLQDFTNEIIAKRIEVRKSGLEVG 265
            .:.|.:::   ::.|..:|:..|...|....:|.:....||...:|::.||.||..:.||. ::|
  Fly   217 SIHAIEEV---MQQRLCNPFFYNIVYFFLFGDYRKQVNNLKIAHEFSSNIIEKRRSLFKSN-QLG 277

  Fly   266 IKADEFSRK-KMAFLDTLLSSKVDGRPLTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDE 329
             :.|||.:| :.|.|||||:::.||: :..|.:.:||:||||||:|||::.:.|.:.:|:.|.|.
  Fly   278 -QEDEFGKKQRYAMLDTLLAAEADGQ-IDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDV 340

  Fly   330 QEKLFNEQCDVMGASGLGRDATFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDYVIDGDIVP 394
            |:|.:.|   :........|.:..:.:.:.:::..|||:.||:||||||||...::.|::|.|:|
  Fly   341 QKKCYEE---IKYLPDDSDDISVFQFNELVYMECVIKESLRLFPSVPFIGRRCVEEGVVNGLIMP 402

  Fly   395 KGTTLNLGLLMLGYNDRVFKDPHKFQPERFDREKP---GPFEYVPFSAGPRNCIGQKFALLEIKT 456
            |.|.:|:.|..:..:.|.|.:|..|||:||..|..   .||.:||||||.|||||||||:||||.
  Fly   403 KNTQINIHLYEIMRDARHFSNPKMFQPDRFFPENTVNRHPFAFVPFSAGQRNCIGQKFAILEIKV 467

  Fly   457 VVSKIIRNFEVLPA--LDELVSKDGYISTT 484
            :::.:||||::||.  ||:|..::|.:..|
  Fly   468 LLAAVIRNFKILPVTLLDDLTFENGIVLRT 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 155/442 (35%)
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 160/454 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460555
Domainoid 1 1.000 160 1.000 Domainoid score I1269
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
99.000

Return to query results.
Submit another query.