DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and Cyp6t1

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster


Alignment Length:456 Identity:101/456 - (22%)
Similarity:183/456 - (40%) Gaps:89/456 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SKSDVYDLTHPWLG-LGLLTSTGSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKKVAD 163
            |:.:..|.|...:| ..|..|....|.:..|:..|.|....:::.:.::.....|..:.:::...
  Fly   123 SRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLS 187

  Fly   164 GGNIFDFQ--EEAHYLTLDVICDTAMGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKYL 226
            |.:..:.:  :.....|.|:|...|.|:..::::|..:.    |:.:...:.    .|  |.|.|
  Fly   188 GRDSMELEVKQLCALFTTDIIASLAFGIEAHSLQNPEAE----FRRMCIEVN----DP--RPKRL 242

  Fly   227 FH-----FAPEY----------PEYSKTLKTLQDFTNEIIAKRIEVRKSGLEVGIKADEFSRKKM 276
            .|     |.|..          .||.:.::...|:   ::::|.|   ||.......|.|.:.|.
  Fly   243 LHLFTMFFFPRLSHRVGTHLYSEEYERFMRKSMDY---VLSQRAE---SGENRHDLIDIFLQLKR 301

  Fly   277 AFLDTLLSSKVDGRPLTSQELYEEVSTF-MFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDV 340
                |..:..:..||    :.:...:.| :..|.||::|.:.||:|.|:::...|::|..|....
  Fly   302 ----TEPAESIIHRP----DFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAA 358

  Fly   341 MGASGLGRDATFQEISTMKHLDLFIKEAQRLYPSVPFIGRF--TEKDYVIDGDIVP--------- 394
            : .|...|..:...::.:.:|...:.|..||||...|:.|.  :...|    |:.|         
  Fly   359 L-QSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGY----DLSPWNGGSPFKL 418

  Fly   395 -KGTTLNLGLLMLGYNDRVFKDPHKFQPERF---DREKPGPFEYVPFSAGPRNCIGQKFALLEIK 455
             .||.:.:.:|.:..:.:.:.:|..|.||||   .|::..|..|:||.||||.|||.....||||
  Fly   419 RAGTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIK 483

  Fly   456 TVVSKIIRNFEVLPALDELVSKDGYISTTLGLQPAEKKSRDAHNHKYDPILSASMTLKSENGLHL 520
            ..:..|:.:|.|                       |...|.....::||   .:..|.:.||.:|
  Fly   484 VGLLHILNHFRV-----------------------EVCERTLPEMRFDP---KAFVLTAHNGTYL 522

  Fly   521 R 521
            |
  Fly   523 R 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 92/402 (23%)
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 96/446 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.