DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e1 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:517 Identity:128/517 - (24%)
Similarity:225/517 - (43%) Gaps:75/517 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IVLCAFLALPLFLVTYFELGLLRRKRMLNKFQGPSMLPLVG-----NAHQMGNTPTEILNRFFGW 62
            |.|.|..||...|:.:.:....|....||.::|....|::.     |.|     |..||.: ...
  Fly     5 IALWACGALLAVLLAWQQRKCWRLIWQLNGWRGVIQQPVLWLLLCINLH-----PNSILEK-VSQ 63

  Fly    63 WHEYGKDNFRYWIGYYSNIMVTNPKYMEFILSSQTLISKSDVYDLTHPWLGL----GLLTSTGSK 123
            :..:.:......:|....:.:.:|..||.:|::...:.|:.:.|      |.    |||.:.|.|
  Fly    64 YRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQD------GFFVRRGLLHARGQK 122

  Fly   124 WHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKKVAD-GGNIFDFQEEAHYLT---LDVICD 184
            |...||.:.|||..||:..|.:|.|....:.::|.:...: .|....|......|:   |:|.|.
  Fly   123 WKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCL 187

  Fly   185 TAMGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKYLFH-FAPE-YPEYSKTLKTLQDFT 247
            |.||...|..:...:.:..::|.:.....:|...||.:.:.|.. .||| |.|..|..|.|:||.
  Fly   188 TIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDFV 252

  Fly   248 NEIIAK-----RIEVRKSGLEVGIKADEFSRKKMAFLDTLLSSKVDGRPLTSQELYEEVSTFMFE 307
            ..|:..     |:.....|.:.|..|....:::: |::.:.....:|. :|.:|:.:|..:.:..
  Fly   253 GGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRI-FIEQIFQLAANGE-MTLEEIMDEAQSMVLV 315

  Fly   308 GHDTTTSGVGFAVYLLSRHP-DEQEKLFNE----QCDVMGASGLGRDATFQEISTMKHLDLFIKE 367
            ..:|.::.:..|:..|:.:. |.|.:|..|    ..|| |..||      :::..:::||.|:.|
  Fly   316 SFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDV-GQVGL------EQLQQLRYLDAFVSE 373

  Fly   368 AQRLYPSVPFIGRFTEKDYVIDG----DIVPKGTTLNLGLLML-------GYNDRVFKDPHKF-- 419
            :.||..:||...|...:|:.:.|    .|||:.:.:.|....:       |.|.|.| ||.:|  
  Fly   374 SLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQF-DPQRFLD 437

  Fly   420 QPE---------------RFDREKPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFE 466
            |.|               |..|::...:.::|||.|.|:|||:::.|..:|..:.|:|.||:
  Fly   438 QEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFD 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 119/486 (24%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 118/480 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.